Property Summary

NCBI Gene PubMed Count 112
Grant Count 151
R01 Count 78
Funding $16,524,719.66
PubMed Score 267.97
PubTator Score 208.89

Knowledge Summary

Patent (10,872)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.813 0.000
ependymoma -1.600 0.000
glioblastoma -1.100 0.001
atypical teratoid/rhabdoid tumor -1.400 0.001
lung cancer -1.500 0.003
adult high grade glioma -1.200 0.042
group 3 medulloblastoma -1.800 0.030

Synonym

Accession Q13507 A7VJS1 E9PCJ9 O00593 Q15660 Q52M35 Q5G1L5 TrpC3
Symbols TRP3
SCA41

Gene

PANTHER Protein Class (2)

Protein-protein Interaction (5)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2770 screening 0 / 0 / 3 Late stage counterscreen results from the probe development effort to identify selective agonists of the Transient Receptor Potential Channels 3 (TRPML3): other ion channel Fura-2 profiling assay

Gene RIF (85)

PMID Text
26215710 The subsequent ER stress-induced apoptosis exhibit a strong requirement for constitutive Ca(2+) influx and that TRPC3 contributes to this process.
26108359 Data show that mechanical stretching of transient receptor potential cation channel, subfamily C, member 3 (TRPC3) overexpressing fibroblasts induced the activation of nuclear factor-kappa B (NFkappaB).
25870279 the first in vivo evidence for a proatherogenic role of endothelial TRPC3.
25533457 Imin channels are regulated by STIM2, TRPC3-containing INS channels are induced by STIM1, and TRPC1-composed Imax channels are activated by both STIM1 and STIM2.
25213992 TRPC3 and TRPC6 participate diversely in synaptic reorganization in the mossy fiber pathway in temporal lobe epilepsy.
24905090 CaSR activation mediates Ca2+ influx and cell proliferation via TRPC3 and TRPC6 in human mesangial cells
24453217 although gene deletion of TRPC3 or TRPC6 alone did not protect against hypertrophy or dysfunction from pressure overload, combined deletion was protective, supporting the value of dual inhibition
23938296 Pdx-1 activates islet alpha- and beta-cell proliferation via a mechanism regulated by transient receptor potential cation channels 3 and 6 and extracellular signal-regulated kinases 1 and 2.
23899746 These data emphasize the role of TRPC3 and Ca(2+) influx in the regulation of BDNF secretion by human airway smooth muscle.
23800762 Removal of a large hydrophobic residue (I667A or I667E) generated TRPC3 channels with approximately 60% constitutive activity, suggesting I667 as part of the dynamic structure occluding the permeation path.
More...

AA Sequence

MREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAV      1 - 70
GNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDE     71 - 140
DGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLA    141 - 210
SPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLE    211 - 280
SAEPLEVHRHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPF    281 - 350
LAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTT    351 - 420
QFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVD    421 - 490
SYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGR    491 - 560
TVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKF    561 - 630
IENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPS    631 - 700
PKSFVYFIMRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMKRL    701 - 770
IKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSMLRCE        771 - 836
//

Publication (115)

PMID Year Title
26215710 2016 Pharmacological evidence for a role of the transient receptor potential canonical 3 (TRPC3) channel in endoplasmic reticulum stress-induced apoptosis of human coronary artery endothelial cells.
26108359 2015 Hypertrophic scar contracture is mediated by the TRPC3 mechanical force transducer via NFkB activation.
25870279 2015 Increased size and cellularity of advanced atherosclerotic lesions in mice with endothelial overexpression of the human TRPC3 channel.
25533457 2015 STIM1 and STIM2 proteins differently regulate endogenous store-operated channels in HEK293 cells.
25477146 2015 Do mutations in the murine ataxia gene TRPC3 cause cerebellar ataxia in humans?
25213992 2015 Upregulation and Diverse Roles of TRPC3 and TRPC6 in Synaptic Reorganization of the Mossy Fiber Pathway in Temporal Lobe Epilepsy.
24905090 2014 Calcium sensing receptor modulates extracellular calcium entry and proliferation via TRPC3/6 channels in cultured human mesangial cells.
24453217 2014 Combined TRPC3 and TRPC6 blockade by selective small-molecule or genetic deletion inhibits pathological cardiac hypertrophy.
23938296 2013 Pdx-1 activates islet ?- and ?-cell proliferation via a mechanism regulated by transient receptor potential cation channels 3 and 6 and extracellular signal-regulated kinases 1 and 2.
23899746 2013 TRPC3 regulates release of brain-derived neurotrophic factor from human airway smooth muscle.
More...