Property Summary

NCBI Gene PubMed Count 28
PubMed Score 14.83
PubTator Score 7.44

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.000
hereditary spastic paraplegia -1.060 0.006
ovarian cancer 1.800 0.004

Synonym

Accession Q13503 B2R4I3 Q6IB05 Q92811
Symbols SRB7
SURB7
hSrb7

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
25100719 Knockdown of mediator complex subunit 21 (MED21) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
20520624 Blocking MED1/MED21 expression caused hyperproliferation of keratinocytes
15710619 Co-expressed yeast MED21 and MED7 in E. coli to determine structure.
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes SRB7, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDID      1 - 70
VLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS     71 - 140
LPDS                                                                      141 - 144
//

Text Mined References (32)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
20520624 2010 The transcriptional coactivator DRIP/mediator complex is involved in vitamin D receptor function and regulates keratinocyte proliferation and differentiation.
19096501 2008 Malleable machines in transcription regulation: the mediator complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15710619 2005 A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...