Property Summary

NCBI Gene PubMed Count 29
PubMed Score 14.43
PubTator Score 7.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
hereditary spastic paraplegia -1.060 5.8e-03
medulloblastoma, large-cell -1.100 7.1e-06
ovarian cancer -1.700 1.1e-03

Synonym

Accession Q13503 B2R4I3 Q6IB05 Q92811
Symbols SRB7
SURB7
hSrb7

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDID      1 - 70
VLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS     71 - 140
LPDS                                                                      141 - 144
//

Text Mined References (33)

PMID Year Title