Property Summary

NCBI Gene PubMed Count 324
Grant Count 59
R01 Count 41
Funding $5,584,732.16
PubMed Score 536.59
PubTator Score 469.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
hepatocellular carcinoma -1.500 0.001
malignant mesothelioma -1.500 0.000
psoriasis -1.500 0.000
osteosarcoma 1.954 0.000
medulloblastoma, large-cell -1.900 0.000
pancreatic ductal adenocarcinoma liver m... 1.692 0.009
tuberculosis -1.300 0.000
non-small cell lung cancer -1.042 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.002
lung cancer -1.100 0.001
group 4 medulloblastoma -1.300 0.002
subependymal giant cell astrocytoma 1.704 0.004
spina bifida -1.234 0.035
ovarian cancer 2.000 0.000
pituitary cancer -2.300 0.000

Synonym

Accession Q13501 A6NFN7 B2R661 B3KUW5 Q13446 Q9BUV7 Q9BVS6 Q9UEU1
Symbols p60
p62
A170
DMRV
OSIL
PDB3
ZIP3
p62B
NADGP
FTDALS3

Gene

PDB

1Q02   2JY7   2JY8   2K0B   2KNV   4MJS   4UF8   4UF9  

Gene RIF (253)

PMID Text
27143478 FRET-based translocation assays reveal that insulin promotes the association of both p62 and aPKC with the insulin-regulated scaffold IRS-1.
26942676 TRIM21 plays an essential role in p62-regulated redox homeostasis and may be a viable target for treating pathological conditions resulting from oxidative damage.
26898796 Our results revealed that oxLDL was dynamically associated with autophagy and 100 mug/ml oxLDL blocked autophagic flux in THP-1 cells.
26754771 SQSTM1 is a novel VANGL2-binding partner and is part of the breast cancer proliferative signal cascade of the VANGL2-SQSTM1-JNK pathway.
26746706 p62 are subjected to parkin mediated proteasomal degradation
26722036 Autophagy status, as determined by combined LC3, Beclin 1 and p62 expression, might be independently associated with poor survival in patients with gastric cancer.
26707573 The present study, for the first time, examined the expression of central autophagy proteins BAG3 and p62 in testicular cancer
26617774 Suggest that Beclin 1 and p62 could serve as potential indicators for the prognosis of patients with non-small cell lung cancer.
26546463 Binding of p62 to the malin-laforin complex allows its recognition by LC3, a component of the autophagosomal membrane.
26496431 our findings suggest the existence of a so-far unrecognized quality control mechanism involving BAG3, HSPB8 and p62/SQSTM1 for accurate remodelling of actin-based mitotic structures that guide spindle orientation.
More...

AA Sequence

MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDE      1 - 70
DGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRY     71 - 140
KCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRP    141 - 210
PRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEE    211 - 280
KSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPST    281 - 350
GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK    351 - 420
NYDIGAALDTIQYSKHPPPL                                                      421 - 440
//

Text Mined References (341)

PMID Year Title
27143478 2016 Protein Scaffolds Control Localized Protein Kinase C? Activity.
26942676 2016 TRIM21 Ubiquitylates SQSTM1/p62 and Suppresses Protein Sequestration to Regulate Redox Homeostasis.
26898796 2016 The roles of p62/SQSTM1 on regulation of matrix metalloproteinase-9 gene expression in response to oxLDL in atherosclerosis.
26754771 2016 Identification of p62/SQSTM1 as a component of non-canonical Wnt VANGL2-JNK signalling in breast cancer.
26746706 2016 Parkin promotes proteasomal degradation of p62: implication of selective vulnerability of neuronal cells in the pathogenesis of Parkinson's disease.
26722036 2016 Clinicopathological Correlations of Autophagy-related Proteins LC3, Beclin 1 and p62 in Gastric Cancer.
26707573 2016 Autophagy-associated proteins BAG3 and p62 in testicular cancer.
26617774 2015 Beclin 1 and p62 expression in non-small cell lung cancer: relation with malignant behaviors and clinical outcome.
26546463 2015 Ubiquitin conjugating enzyme E2-N and sequestosome-1 (p62) are components of the ubiquitination process mediated by the malin-laforin E3-ubiquitin ligase complex.
26496431 2015 A Role for the Chaperone Complex BAG3-HSPB8 in Actin Dynamics, Spindle Orientation and Proper Chromosome Segregation during Mitosis.
More...