Property Summary

NCBI Gene PubMed Count 100
PubMed Score 84.71
PubTator Score 96.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.200 3.9e-02
Astrocytoma, Pilocytic 1.100 3.7e-02
atypical teratoid / rhabdoid tumor 1.500 2.9e-03
Breast cancer -1.100 2.8e-11
dermatomyositis 1.300 3.1e-04
Down syndrome 1.100 6.2e-03
ependymoma 1.300 2.0e-03
Gaucher disease type 1 -1.600 2.5e-02
glioblastoma 1.100 2.9e-02
group 4 medulloblastoma -1.100 1.5e-02
juvenile dermatomyositis 1.082 1.5e-10
lung adenocarcinoma 1.549 8.3e-07
lung cancer -1.400 2.2e-02
medulloblastoma, large-cell -2.100 9.1e-05
Multiple myeloma 1.130 1.2e-04
osteosarcoma 2.826 2.0e-06
ovarian cancer -1.400 7.7e-05
progressive supranuclear palsy -1.100 9.2e-03
psoriasis 1.100 3.2e-03

Protein-protein Interaction (11)

Gene RIF (83)

AA Sequence

MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNS      1 - 70
SWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQ     71 - 140
VAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAA    141 - 210
YNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQ    211 - 280
HLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKP    281 - 350
HTSLTTAASPVSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGD    351 - 420
PFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFE    421 - 490
SVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKN    491 - 560
DVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIY    561 - 630
SQPVMRPPNPFGPVSGAQIQFM                                                    631 - 652
//

Text Mined References (111)

PMID Year Title