Property Summary

NCBI Gene PubMed Count 89
Grant Count 35
R01 Count 13
Funding $3,576,221.47
PubMed Score 81.15
PubTator Score 96.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.130 0.000
psoriasis 1.100 0.003
osteosarcoma 2.826 0.000
ependymoma 1.300 0.002
astrocytoma 1.200 0.039
glioblastoma 1.100 0.029
atypical teratoid / rhabdoid tumor 1.500 0.003
medulloblastoma -1.100 0.002
medulloblastoma, large-cell -2.100 0.000
juvenile dermatomyositis 1.082 0.000
lung cancer -1.400 0.022
pilocytic astrocytoma 1.100 0.039
lung adenocarcinoma 1.549 0.000
progressive supranuclear palsy -1.100 0.009
Breast cancer -1.100 0.000
ovarian cancer 1.600 0.000
Gaucher disease type 1 -1.600 0.025
Down syndrome 2.000 0.001
dermatomyositis 2.000 0.000

Gene RIF (73)

PMID Text
26434199 the rs541458 and rs3851179 of PICALM SNPs are not related to development of behavioral and psychological symptoms of dementia in Turkish population
25898166 CALM is a major factor in controlling endocytic clathrin-coated vesicle size and maturation and hence in determining the rates of endocytic cargo uptake.
25359311 We detected a significant association of the MTHFR rs1801133 and PICALM rs3851179 polymorphisms with AD.
25241929 PICALM has a role in modulating autophagy activity and tau accumulation
25169757 allelic expression has shown that compelling PICALM allelic expression imbalance was not observed in most brain RNA samples
25022885 PICALM SNP is significantly associated with late onset Alzheimer disease.
24660791 physical activity attenuated the effects of genetic risk (ie. the constellation of PICALM, BIN1, and CLU polymorphisms) on episodic memory
24618820 multiple PICALM isoforms are expressed in the human brain, that PICALM is robustly expressed in microvessels, and that expression of total PICALM is modestly correlated with the AD-associated SNP rs3851179.
24613704 Data suggest a neural mechanism for APOE-PICALM interactions in patients with manifest Alzheimer's disease and indicate that the PICALM genotype modulates both brain atrophy and cognitive performance in APOE epsilon4 carrier
24578178 PICALM and CLU risk genotypes exert differential impacts on the hippocampal resting-state functional connectivity in healthy young subjects.
More...

AA Sequence

MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNS      1 - 70
SWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQ     71 - 140
VAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAA    141 - 210
YNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQ    211 - 280
HLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKP    281 - 350
HTSLTTAASPVSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGD    351 - 420
PFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFE    421 - 490
SVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKN    491 - 560
DVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIY    561 - 630
SQPVMRPPNPFGPVSGAQIQFM                                                    631 - 652
//

Text Mined References (100)

PMID Year Title
26434199 2015 LACK OF ASSOCIATIONS BETWEEN CLU AND PICALM GENE POLYMORPHISMS AND ALZHEIMER'S DISEASE IN A TURKISH POPULATION.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25898166 2015 CALM regulates clathrin-coated vesicle size and maturation by directly sensing and driving membrane curvature.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25359311 2015 Association of MTHFR and PICALM polymorphisms with Alzheimer's disease.
25241929 2014 PICALM modulates autophagy activity and tau accumulation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25169757 2014 An intronic PICALM polymorphism, rs588076, is associated with allelic expression of a PICALM isoform.
25022885 2014 Genetic evidence for the involvement of variants at APOE, BIN1, CR1, and PICALM loci in risk of late-onset Alzheimer's disease and evaluation for interactions with APOE genotypes.
24660791 2014 The benefits of staying active in old age: physical activity counteracts the negative influence of PICALM, BIN1, and CLU risk alleles on episodic memory functioning.
More...