Property Summary

NCBI Gene PubMed Count 23
PubMed Score 46.25
PubTator Score 31.82

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13491 O76077 Q86X43 Q8N956 M6b
Symbols M6B

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
25113253 Increase in the expression levels of mRNA and protein for the Gpm6B is associated with various types of gynaecological malignancy.
24916915 Data indicate that neuronal membrane glycoproteins GPM6A and GPM6B may act as novel oncogenes in the development of lymphoid leukemia.
24696529 Circulating levels of DR6 and Gpm6B correlate with breast cancer tumor grade.
23950870 Data show the Differences in high resolution melting analysis in promoters of tumor markers neuronal membrane glycoprotein M6-B, melanoma antigen family A12 and immunoglobulin superfamily Fc receptor indicated invasiveness of hepatocellular carcinoma.
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein glycoprotein M6B (GPM6B), which co-localizes with Nef at the cellular perinuclear region and in most of the vesicular compartments
21638316 Microarray expression analysis of GPM6B-depleted osteogenic human mesenchymal stem cells revealed significant changes in genes involved in cytoskeleton organization and biogenesis.
18581270 Data suggest that M6B regulates serotonin uptake by affecting cellular trafficking of the serotonin transporter.
17918249 Observational study of gene-disease association. (HuGE Navigator)
16416265 Observational study of gene-disease association. (HuGE Navigator)
15214007 it is unlikely that mutations in M6B have a role in Pelizaeus-Merzbacher-like syndrome, as examined in eight patients

AA Sequence

MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHF      1 - 70
STNASDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLT     71 - 140
YVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALE    141 - 210
NICNTNEFYMSYHLFIVACAGAGATVIALLIYMMATTYNYAVLKFKSREDCCTKF                   211 - 265
//

Text Mined References (25)

PMID Year Title
25113253 2014 Vascular marker expression during the development of various types of gynaecological malignancy.
24916915 2014 Identification of GPM6A and GPM6B as potential new human lymphoid leukemia-associated oncogenes.
24696529 2014 Breast carcinoma progression and tumour vascular markers related to apoptotic mechanisms.
23950870 2013 Discovery and validation of DNA hypomethylation biomarkers for liver cancer using HRM-specific probes.
21638316 2011 GPM6B regulates osteoblast function and induction of mineralization by controlling cytoskeleton and matrix vesicle release.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18581270 2009 Membrane glycoprotein M6B interacts with the human serotonin transporter.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17918249 2008 Fetal hemoglobin in sickle cell anemia: Bayesian modeling of genetic associations.
16416265 2006 PLP1 and GPM6B intragenic copy number analysis by MAPH in 262 patients with hypomyelinating leukodystrophies: Identification of one partial triplication and two partial deletions of PLP1.
More...