Property Summary

NCBI Gene PubMed Count 23
PubMed Score 47.78
PubTator Score 31.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 1.159 1.5e-04
adrenocortical adenoma -2.085 3.4e-04
adrenocortical carcinoma -2.439 3.8e-11
aldosterone-producing adenoma -1.358 2.9e-02
atypical teratoid / rhabdoid tumor -2.300 1.8e-03
Breast cancer -3.700 4.9e-19
breast carcinoma -2.300 1.1e-29
colon cancer -1.400 1.7e-03
cystic fibrosis -1.616 7.4e-06
Duchenne muscular dystrophy 1.126 1.8e-06
facioscapulohumeral dystrophy -1.400 2.3e-02
glioblastoma -1.200 3.8e-02
group 3 medulloblastoma -2.500 4.9e-08
intraductal papillary-mucinous adenoma (... -2.300 2.0e-03
intraductal papillary-mucinous carcinoma... -2.200 3.1e-03
intraductal papillary-mucinous neoplasm ... -1.800 4.2e-02
invasive ductal carcinoma -1.797 6.4e-06
lung adenocarcinoma -1.200 5.4e-08
lung cancer -1.300 7.2e-03
medulloblastoma, large-cell -3.600 7.3e-07
nephrosclerosis 1.214 6.8e-04
non-small cell lung cancer -1.873 2.7e-15
osteosarcoma -2.062 1.8e-02
ovarian cancer 2.000 2.1e-06
pituitary cancer -3.000 5.7e-07
psoriasis -1.400 4.4e-07

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHF      1 - 70
STNASDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLT     71 - 140
YVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALE    141 - 210
NICNTNEFYMSYHLFIVACAGAGATVIALLIYMMATTYNYAVLKFKSREDCCTKF                   211 - 265
//

Text Mined References (25)

PMID Year Title