Property Summary

NCBI Gene PubMed Count 166
Grant Count 68
R01 Count 48
Funding $3,942,877.6
PubMed Score 294.97
PubTator Score 259.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.438 0.005
psoriasis 1.600 0.000
juvenile dermatomyositis 1.083 0.000
tuberculosis -1.400 0.000
ovarian cancer -1.500 0.000
dermatomyositis 1.200 0.001

Synonym

Accession Q13490 B4E026 Q16516 Q4TTG0
Symbols API1
MIHB
HIAP2
RNF48
cIAP1
Hiap-2
c-IAP1

Gene

PANTHER Protein Class (2)

PDB

1QBH   2L9M   3D9T   3D9U   3M1D   3MUP   3OZ1   3T6P   3UW4   4EB9   4HY4   4HY5   4KMN   4LGE   4LGU   4MTI   4MU7  

Gene RIF (121)

PMID Text
27070702 cIAP1 and cIAP2 mediate BCL10 ubiquitination essential for BCR-dependent NF-kB activity in the ABC subtype of DLBCL. cIAP1/2 attach K63-linked polyubiquitin chains on themselves and on BCL10, recruiting IKK and LUBAC essential for IKK activation.
26314849 AZD5582 draws Mcl-1 down-regulation for induction of apoptosis through targeting of cIAP1 and XIAP in human pancreatic cancer
26168135 cIAP1 is associated with tumor progression in human ovarian cancer.
26011589 Data show that ectopic expression of interferon regulatory factor 1 (IRF-1) reduces NF-kappa B activity and suppresses TNF receptor-associated factor 2 (TRAF2) and inhibitor of apoptosis 1 protein (cIAP1) expression in breast cancer cells.
25911380 Data suggest that the seventh zinc finger motif of DNA-binding protein A20 plays important role in NFkappaB-mediated apoptosis induced by tumor necrosis factor-alpha; A20 appears to bind and thus down-regulate inhibitor of apoptosis proteins cIAP1/2.
25669656 The E3 ubiquitin ligase activity of XIAP and cIAP1 activates NFkappaB signalling, leading to the direct binding of p65 to the promoter of Beclin 1 and to its transcriptional activation and induction of autophagy.
25635055 Survivin affected the stability of cIAP1 through binding, contributing to cell sensitivity to antineoplastic drug YM155.
25549803 Data indicate that Smac/DIABLO showed an inverse correlation with inhibitor of apoptosis proteins XIAP, cIAP-1 and cIAP-2.
25469840 cIAP1 undergoes a dramatic conformational change during activation that is now shown to be due to the dynamic and metastable nature of the closed form of the enzyme.
25383668 Although motions within each interface of the 'closed' monomer are insufficient to activate cIAP1, they enable associations with catalytic partners and activation factors.
More...

AA Sequence

MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARA      1 - 70
GFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLS     71 - 140
PTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFY    141 - 210
YIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWP    211 - 280
SSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQG    281 - 350
RYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT    351 - 420
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINK    421 - 490
QEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEE    491 - 560
QLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS                561 - 618
//

Text Mined References (174)

PMID Year Title
27070702 2016 Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma.
26314849 2015 A novel small-molecule IAP antagonist, AZD5582, draws Mcl-1 down-regulation for induction of apoptosis through targeting of cIAP1 and XIAP in human pancreatic cancer.
26168135 2014 shRNA Depletion of cIAP1 Sensitizes Human Ovarian Cancer Cells to Anticancer Agent-Induced Apoptosis.
26011589 2015 IRF-1 inhibits NF-?B activity, suppresses TRAF2 and cIAP1 and induces breast cancer cell specific growth inhibition.
25911380 2015 The seventh zinc finger motif of A20 is required for the suppression of TNF-?-induced apoptosis.
25669656 2015 XIAP and cIAP1 amplifications induce Beclin 1-dependent autophagy through NF?B activation.
25635055 2015 Cellular inhibitor of apoptosis protein 1 (cIAP1) stability contributes to YM155 resistance in human gastric cancer cells.
25549803 2015 Prognostic value of inhibitor of apoptosis protein family expression in patients with acute myeloid leukemia.
25486457 2015 Middle domain of human Hsp90 isoforms differentially binds Aha1 in human cells and alters Hsp90 activity in yeast.
25469840 2014 Dynamic activation of apoptosis: conformational ensembles of cIAP1 are linked to a spring-loaded mechanism.
More...