Property Summary

Ligand Count 306
NCBI Gene PubMed Count 175
PubMed Score 308.71
PubTator Score 259.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
juvenile dermatomyositis 1187 6.1e-10
tuberculosis 2010 7.7e-09
ovarian cancer 8520 9.3e-05
psoriasis 6694 2.2e-04
dermatomyositis 966 1.0e-03
Multiple myeloma 1332 4.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 5.151 2.6
X-linked lymphoproliferative syndrome 2 4 3.412 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.200 1.0e-03
juvenile dermatomyositis 1.083 6.1e-10
Multiple myeloma 1.438 4.6e-03
ovarian cancer -1.500 9.3e-05
psoriasis 1.600 2.2e-04
tuberculosis -1.400 7.7e-09

Protein-protein Interaction (10)

PDB (18)

Gene RIF (128)

AA Sequence

MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARA      1 - 70
GFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLS     71 - 140
PTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFY    141 - 210
YIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWP    211 - 280
SSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQG    281 - 350
RYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT    351 - 420
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINK    421 - 490
QEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEE    491 - 560
QLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS                561 - 618
//

Text Mined References (184)

PMID Year Title