Property Summary

Ligand Count 87
NCBI Gene PubMed Count 180
PubMed Score 373.21
PubTator Score 325.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7
Disease Target Count Z-score Confidence
Cancer 2499 5.37 2.7
Edwards syndrome 17 3.533 1.8
Disease Target Count
MALT lymphoma 6

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.937 1.7e-02
active ulcerative colitis 2.176 3.3e-02
Atopic dermatitis 1.700 1.6e-03
Bipolar Disorder 1.085 4.0e-02
cutaneous lupus erythematosus 2.600 1.0e-03
cystic fibrosis -1.200 2.0e-03
esophageal adenocarcinoma 1.700 2.1e-02
head and neck cancer 1.400 2.1e-03
interstitial cystitis 2.200 5.1e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.6e-02
lung cancer -1.800 4.3e-04
lung carcinoma -2.700 1.7e-19
malignant mesothelioma 1.100 1.2e-05
non-small cell lung cancer -1.063 1.0e-05
osteosarcoma -2.302 6.2e-03
ovarian cancer -1.700 5.7e-03
pancreatic cancer 1.500 5.4e-04
pancreatic ductal adenocarcinoma liver m... 2.098 3.4e-02
posterior fossa group A ependymoma 1.500 4.9e-03
primary Sjogren syndrome 1.700 6.6e-03
psoriasis 1.200 4.8e-03
spina bifida -2.635 4.1e-02
tuberculosis -2.400 6.6e-08

Protein-protein Interaction (2)

Gene RIF (150)

AA Sequence

MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCG      1 - 70
LMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSN     71 - 140
SPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGG    141 - 210
KLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAG    211 - 280
FYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSD    281 - 350
SPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL    351 - 420
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSL    421 - 490
QARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVC    491 - 560
MDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS                              561 - 604
//

Text Mined References (183)

PMID Year Title