Property Summary

NCBI Gene PubMed Count 168
Grant Count 117
R01 Count 81
Funding $8,960,709.56
PubMed Score 360.36
PubTator Score 325.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
esophageal adenocarcinoma 1.700 0.021
cutaneous lupus erythematosus 2.600 0.001
psoriasis 1.500 0.000
osteosarcoma -2.302 0.006
Atopic dermatitis 1.700 0.002
tuberculosis -2.400 0.000
pancreatic ductal adenocarcinoma liver m... 2.098 0.034
non-small cell lung cancer -1.465 0.000
intraductal papillary-mucinous neoplasm ... 2.200 0.016
lung cancer -1.800 0.000
active Crohn's disease 1.937 0.017
ulcerative colitis 2.400 0.000
pancreatic cancer 1.500 0.001
interstitial cystitis 2.200 0.005
cystic fibrosis -1.200 0.002
posterior fossa group A ependymoma 1.500 0.005
primary Sjogren syndrome 1.700 0.007
lung carcinoma -2.700 0.000
spina bifida -2.635 0.041
Bipolar Disorder 1.085 0.040
ovarian cancer -1.700 0.006
head and neck cancer 1.400 0.002

Synonym

Accession Q13489 Q16628 Q9HC27 Q9UP46
Symbols AIP1
API2
MIHC
CIAP2
HAIP1
HIAP1
MALT2
RNF49
c-IAP2

Gene

PANTHER Protein Class (2)

PDB

2UVL   3EB5   3EB6   3M0A   3M0D  

Gene RIF (138)

PMID Text
27070702 cIAP1 and cIAP2 mediate BCL10 ubiquitination essential for BCR-dependent NF-kB activity in the ABC subtype of DLBCL. cIAP1/2 attach K63-linked polyubiquitin chains on themselves and on BCL10, recruiting IKK and LUBAC essential for IKK activation.
26513451 cIAP2 is upregulated in regenerative epithelial cells both in ulcerative colitis and in experimental intestinal wounds. Inhibition of cIAP2 decreases wound healing in vitro possibly through inhibition of migration. [review]
26291056 this study candidates BIRC3 as one of the potentially useful predictive marker for discriminating patients with oesophageal and oesophagogastric junction adenocarcinoma who will most likely benefit from preoperative chemoradiotherapy.
26077759 these results indicate that N. gonorrhoeae stimulation of human endocervical epithelial cells induces the release of cIAP2, an essential regulator of cell death and immune signaling.
25911380 Data suggest that the seventh zinc finger motif of DNA-binding protein A20 plays important role in NFkappaB-mediated apoptosis induced by tumor necrosis factor-alpha; A20 appears to bind and thus down-regulate inhibitor of apoptosis proteins cIAP1/2.
25692408 LapR cells possessed increased levels of 2 of the inhibitors of apoptosis (IAPs), survivin and c-IAP-2, which are reported to block caspase activation downstream of cytosolic cytochrome C release.
25569716 API2-MALT1 induces paracaspase-mediated cleavage of the tumour suppressor protein LIMA1.
25549803 Data indicate that Smac/DIABLO showed an inverse correlation with inhibitor of apoptosis proteins XIAP, cIAP-1 and cIAP-2.
25513960 TNF-alpha induced apoptosis of gastric cancer cells via accelerated degradation of the inhibitor of apoptosis family members, CIAP2, XIAP, and survivin.
25394657 cIAP2 is in conclusion a regulator of human intestinal wound healing through enhanced migration along with activation of Rac1
More...

AA Sequence

MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCG      1 - 70
LMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSN     71 - 140
SPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGG    141 - 210
KLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAG    211 - 280
FYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSD    281 - 350
SPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL    351 - 420
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSL    421 - 490
QARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVC    491 - 560
MDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS                              561 - 604
//

Text Mined References (171)

PMID Year Title
27070702 2016 Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma.
26513451 2015 Regulation of antiapoptotic and cytoprotective pathways in colonic epithelial cells in ulcerative colitis.
26291056 2015 TAK1-regulated expression of BIRC3 predicts resistance to preoperative chemoradiotherapy in oesophageal adenocarcinoma patients.
26077759 2015 Neisseria gonorrhoeae Modulates Cell Death in Human Endocervical Epithelial Cells through Export of Exosome-Associated cIAP2.
25911380 2015 The seventh zinc finger motif of A20 is required for the suppression of TNF-?-induced apoptosis.
25692408 2015 PI3K-independent mTOR activation promotes lapatinib resistance and IAP expression that can be effectively reversed by mTOR and Hsp90 inhibition.
25569716 2015 Conversion of the LIMA1 tumour suppressor into an oncogenic LMO-like protein by API2-MALT1 in MALT lymphoma.
25549803 2015 Prognostic value of inhibitor of apoptosis protein family expression in patients with acute myeloid leukemia.
25513960 2015 Tumor necrosis factor-?-induced apoptosis of gastric cancer MKN28 cells: accelerated degradation of the inhibitor of apoptosis family members.
25394657 2015 Cellular inhibitor of apoptosis protein 2 controls human colonic epithelial restitution, migration, and Rac1 activation.
More...