Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.00
PubTator Score 6.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.1e-06
Disease Target Count Z-score Confidence
Panic disorder 61 3.995 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 1.1e-06

Synonym

Accession Q13487 B2RBZ6 D6W663 Q13486 SNAPc subunit 2
Symbols SNAP45
PTFDELTA

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MKPPPRRRAAPARYLGEVTGPATWSAREKRQLVRLLQARQGQPEPDATELARELRGRSEAEIRVFLQQLK      1 - 70
GRVAREAIQKVHPGGLQGPRRREAQPPAPIEVWTDLAEKITGPLEEALAVAFSQVLTIAATEPVTLLHSK     71 - 140
PPKPTQARGKPLLLSAPGGQEDPAPEIPSSAPAAPSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIY    141 - 210
KYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLPCTALVEHMTETYLRLTAPQPIPAGGSLGPAAE    211 - 280
GDGAGSKAPEETPPATEKAEHSELKSPWQAAGICPLNPFLVPLELLGRAATPAR                    281 - 334
//

Text Mined References (18)

PMID Year Title