Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $191,175.2
PubMed Score 3.00
PubTator Score 6.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Panic disorder 55 3.973 2.0
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 0.000

Gene RIF (2)

PMID Text
21444690 The findings invoke a model wherein incomplete DNA synthesis during S phase leads to a DNA damage response and formation of 53BP1-OPT domains in the subsequent G1.
18356157 SNAP45 plays two roles in the cell, one as a subunit of the transcription factor SNAP(c) and another as a factor required for proper mitotic progression

AA Sequence

MKPPPRRRAAPARYLGEVTGPATWSAREKRQLVRLLQARQGQPEPDATELARELRGRSEAEIRVFLQQLK      1 - 70
GRVAREAIQKVHPGGLQGPRRREAQPPAPIEVWTDLAEKITGPLEEALAVAFSQVLTIAATEPVTLLHSK     71 - 140
PPKPTQARGKPLLLSAPGGQEDPAPEIPSSAPAAPSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIY    141 - 210
KYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLPCTALVEHMTETYLRLTAPQPIPAGGSLGPAAE    211 - 280
GDGAGSKAPEETPPATEKAEHSELKSPWQAAGICPLNPFLVPLELLGRAATPAR                    281 - 334
//

Text Mined References (18)

PMID Year Title
21444690 2011 Replication stress induces 53BP1-containing OPT domains in G1 cells.
18356157 2008 Mitotic functions for SNAP45, a subunit of the small nuclear RNA-activating protein complex SNAPc.
16769183 2006 A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621023 2003 The small nuclear RNA-activating protein 190 Myb DNA binding domain stimulates TATA box-binding protein-TATA box recognition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11318610 2001 A physical and transcript map of the MCOLN1 gene region on human chromosome 19p13.3-p13.2.
11056176 2001 A map of protein-protein contacts within the small nuclear RNA-activating protein complex SNAPc.
More...