Property Summary

NCBI Gene PubMed Count 496
Grant Count 673
R01 Count 443
Funding $53,991,602.89
PubMed Score 1149.70
PubTator Score 948.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.300 0.041
oligodendroglioma 1.200 0.036
osteosarcoma -1.410 0.000
group 4 medulloblastoma 1.800 0.001
medulloblastoma, large-cell 1.300 0.000
acute quadriplegic myopathy 1.049 0.001
pediatric high grade glioma 1.100 0.004
subependymal giant cell astrocytoma -1.575 0.029
Breast cancer -1.400 0.000
ovarian cancer -2.400 0.000

Synonym

Accession Q13485 A8K405 MAD homolog 4
Symbols JIP
DPC4
MADH4
MYHRS

Gene

PANTHER Protein Class (1)

PDB

1DD1   1G88   1MR1   1U7F   1U7V   1YGS  

Gene RIF (364)

PMID Text
26974954 data suggest that TGF-beta1 enhances IGFBP7 via Smad2/4 pathways, and that IGFBP7 might be involved in the TGF-beta1-induced tubular injury in DN.
26817584 Study shows the upregulation of miR-130a and inactivation of Smad4 in gemcitabine resistant hepatocellular carcinoma cells, (HCC) and describes a potential mechanism for dysregulation of Smad4 by miR-130a-3p in HCC.
26754455 In operated pancreatic adenocarcinoma, incidence of mutations was: SMAD4 = 20%.
26747772 MicroRNA-483-3p has an inhibitory effect on ECM production in HTMCs through downregulating Smad4, which indicates that miR-483-3p may serve as a potential therapeutic target in glaucoma.
26699655 Smad4-dependent TGF-beta signaling in smooth muscle cells protects against aortic aneurysm formation and dissection.
26647806 we discovered a novel mechanism mediated by Smad4 to trigger 5-FU chemosensitivity through cell cycle arrest by inhibiting the PI3K/Akt/CDC2/survivin cascade.
26625141 Transcription factor SMAD4 (a part of the TGF-beta signaling pathway) activates Fn14 expression. Then, activated Fn14 expression increases extracellular matrix synthesis and fibroblast activation.
26464677 The reverse correlation of Jab1 and Smad4 in PANC-1 cells may be involved in the Pathogenesis of prostate cancer. Jab1 can cause degradation of Smad4 via TGF-beta signal pathway.
26383977 Relationship between Expression of TGF-beta1, Smad2, Smad4 and Prognosis of Patients with Resected Non-small Cell Lung Cancer
26341919 Loss of SMAD4 was significantly associated with CCL15 expression.
More...

AA Sequence

MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSK      1 - 70
CVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPG     71 - 140
IDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATS    141 - 210
TANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNL    211 - 280
PHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTV    281 - 350
DGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR    351 - 420
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGI    421 - 490
GVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD            491 - 552
//

Text Mined References (505)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26974954 2016 Role of IGFBP7 in Diabetic Nephropathy: TGF-?1 Induces IGFBP7 via Smad2/4 in Human Renal Proximal Tubular Epithelial Cells.
26878725 2016 Mutations in nuclear pore genes NUP93, NUP205 and XPO5 cause steroid-resistant nephrotic syndrome.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26817584 2016 MiR-130a-3p regulates cell migration and invasion via inhibition of Smad4 in gemcitabine resistant hepatoma cells.
26754455 2016 Using next-generation sequencing to determine potential molecularly guided therapy options for patients with resectable pancreatic adenocarcinoma.
26747772 2015 MicroRNA-483-3p Inhibits Extracellular Matrix Production by Targeting Smad4 in Human Trabecular Meshwork Cells.
26699655 2016 Smad4 Deficiency in Smooth Muscle Cells Initiates the Formation of Aortic Aneurysm.
26647806 2016 Smad4 sensitizes colorectal cancer to 5-fluorouracil through cell cycle arrest by inhibiting the PI3K/Akt/CDC2/survivin cascade.
26625141 2015 Fn14, a Downstream Target of the TGF-? Signaling Pathway, Regulates Fibroblast Activation.
More...