Property Summary

NCBI Gene PubMed Count 115
Grant Count 92
R01 Count 62
Funding $5,996,698.59
PubMed Score 45.97
PubTator Score 115.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
pancreatic cancer 1.300 0.003
psoriasis -1.600 0.000
osteosarcoma -1.135 0.007
chronic lymphosyte leukemia 1.400 0.000
posterior fossa group A ependymoma 1.300 0.000
glioblastoma 1.200 0.000
sonic hedgehog group medulloblastoma 2.800 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
non-small cell lung cancer -1.500 0.000
lung cancer -2.800 0.000
colon cancer -2.200 0.000
Breast cancer 2.300 0.026
lung adenocarcinoma -1.100 0.000
pediatric high grade glioma 1.200 0.003
pilocytic astrocytoma 1.600 0.000
pancreatic carcinoma 1.300 0.003
lung carcinoma -1.600 0.000
spina bifida -1.769 0.049
progressive supranuclear palsy -1.300 0.033
ulcerative colitis -1.400 0.000
ovarian cancer -2.100 0.000

Synonym

Accession Q13480 A8K152 Q4W5G2 Q6P1W2
Symbols

Gene

PDB

4QSY  

 GO Component (1)

 GWAS Trait (1)

Gene RIF (63)

PMID Text
26183772 CVB3 targets host GAB1 to generate a GAB1-N1-174 fragment that enhances viral infectivity, at least in part, via activation of the ERK pathway
26090437 Gab1 protein was upregulated in cyanotic compared to acyanotic hearts suggesting that Gab1 upregulation is a component of the survival program initiated by hypoxia in cyanotic children
26014518 We found that expression of Gab1, VEGFR-2, and MMP-9 was highly and positively correlated with each other and with lymph node metastasis and TNM stage in intrahepatic cholangiocarcinoma tissues
25991585 Data demonstrate that miR-409-3p is a metastatic suppressor, and post-transcriptional inhibition of the oncoprotein GAB1 is one of its mechanisms of action.
25969544 EGFR-activated Src family kinases maintain GAB1-SHP2 complexes distal from EGFR.
25596749 Results suggest that Gab1 is an essential regulator of the EGF-mediated mTORC pathways and may potentially be used as a biomarker for urothelial carcinoma
25569504 Studied the pleckstrin homology (PH) domain of GAB1 for cancer treatment. Using homology models we derived, high-throughput virtual screening of five million compounds resulted in five hits which exhibited strong binding affinities to GAB1 PH domain.
25217982 This study suggests potential effects of SNPs of Gab1 on the onset and susceptibility of biliary tract cancer.
25144631 Endometrial GAB1 protein and mRNA expression are reduced in women with PCOS, suggesting that the endometrium of PCOS women have a defect in insulin signaling due to GAB1 down-regulation.
25078664 Galphai1/3 proteins lie downstream of KGFR, but upstream of Gab1-mediated activation of PI3K-AKT-mTORC1 signaling.
More...

AA Sequence

MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDA      1 - 70
GLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPL     71 - 140
AINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTHADSAKSTSSE    141 - 210
TDCNDNVPSHKNPASSQSKHGMNGFFQQQMIYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEA    211 - 280
DGELYVFNTPSGTSSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHP    281 - 350
AHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL    351 - 420
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVP    421 - 490
PPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARD    491 - 560
SSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDL    561 - 630
DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK          631 - 694
//

Text Mined References (121)

PMID Year Title
26183772 2015 Enhanced enteroviral infectivity via viral protease-mediated cleavage of Grb2-associated binder 1.
26090437 2015 Gab1 Is Modulated by Chronic Hypoxia in Children with Cyanotic Congenital Heart Defect and Its Overexpression Reduces Apoptosis in Rat Neonatal Cardiomyocytes.
26014518 2015 Gab1 regulates proliferation and migration through the PI3K/Akt signaling pathway in intrahepatic cholangiocarcinoma.
25991585 2015 MicroRNA-409-3p suppresses colorectal cancer invasion and metastasis partly by targeting GAB1 expression.
25969544 2015 EGFR-activated Src family kinases maintain GAB1-SHP2 complexes distal from EGFR.
25596749 2015 Gab1 is essential for membrane translocation, activity and integrity of mTORCs after EGF stimulation in urothelial cell carcinoma.
25569504 2015 Novel inhibitors induce large conformational changes of GAB1 pleckstrin homology domain and kill breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25217982 2014 Essential role of polymorphism of Gab1, EGFR, and EGF for the susceptibility of biliary tract cancer.
More...