Property Summary

NCBI Gene PubMed Count 124
PubMed Score 50.42
PubTator Score 115.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (21)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.3e-05
atypical teratoid / rhabdoid tumor 1.100 1.0e-03
Breast cancer 2.300 2.6e-02
chronic lymphosyte leukemia 1.100 1.2e-04
colon cancer -1.500 3.8e-03
ependymoma 1.100 3.5e-05
glioblastoma 1.100 1.3e-04
lung adenocarcinoma -1.100 5.0e-15
lung cancer -2.500 1.0e-04
lung carcinoma -1.600 4.8e-17
medulloblastoma 1.300 1.9e-02
non-small cell lung cancer -1.500 1.9e-17
osteosarcoma -1.135 6.7e-03
ovarian cancer -1.100 1.2e-05
pancreatic cancer 1.300 3.3e-03
pancreatic carcinoma 1.300 3.3e-03
pediatric high grade glioma 1.200 3.2e-03
progressive supranuclear palsy -1.200 7.4e-03
psoriasis -1.600 1.7e-04
spina bifida -1.769 4.9e-02
ulcerative colitis -1.100 1.3e-07

 GO Component (1)

 GWAS Trait (1)

Gene RIF (71)

AA Sequence

MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDA      1 - 70
GLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPL     71 - 140
AINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTHADSAKSTSSE    141 - 210
TDCNDNVPSHKNPASSQSKHGMNGFFQQQMIYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEA    211 - 280
DGELYVFNTPSGTSSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHP    281 - 350
AHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL    351 - 420
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVP    421 - 490
PPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARD    491 - 560
SSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDL    561 - 630
DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK          631 - 694
//

Text Mined References (130)

PMID Year Title