Property Summary

NCBI Gene PubMed Count 83
PubMed Score 28.80
PubTator Score 174.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Brain Injuries 65 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Asthma 385 3.774 1.9
Atopic dermatitis 952 0.0 3.0
Celiac disease 116 0.0 3.0

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.057 3.7e-03
interstitial cystitis 1.400 3.4e-03
lung adenocarcinoma -1.300 7.7e-09
lung cancer -1.800 1.3e-02
lung carcinoma -2.500 3.2e-16
malignant mesothelioma -4.200 6.3e-08
non-small cell lung cancer -1.219 4.9e-13
osteosarcoma -2.978 1.4e-05
pituitary cancer -1.100 2.2e-03
ulcerative colitis 1.200 5.5e-04

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (68)

AA Sequence

MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNP      1 - 70
RSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFTERQVTSKIVEVKKFFQITC     71 - 140
ENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFNITKTFNITIVEDR    141 - 210
SNIVPVLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASK    211 - 280
VLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVI    281 - 350
YRVDLVLFYRHLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV    351 - 420
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVTDFTFLPQSLK    421 - 490
LLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSES                       491 - 541
//

Text Mined References (84)

PMID Year Title