Property Summary

NCBI Gene PubMed Count 80
PubMed Score 27.99
PubTator Score 174.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Dermatitis, Atopic 45
Disease Target Count P-value
non-small cell lung carcinoma 413 1.85361263667952E-22
lung carcinoma 2844 3.18068994141815E-16
lung adenocarcinoma 2714 4.00417924982514E-13
malignant mesothelioma 3163 6.30865084466611E-8
osteosarcoma 7933 1.41815124664045E-5
lung cancer 4473 5.24448098850244E-5
interstitial cystitis 2299 9.67002647298889E-5
ulcerative colitis 2087 5.52529077511047E-4
pituitary cancer 1972 0.00216224123525756
active Crohn's disease 918 0.00370739220573088
Disease Target Count Z-score Confidence
Asthma 349 3.789 1.9
Atopic dermatitis 944 0.0 2.0
Celiac disease 112 0.0 2.0
Disease Target Count Z-score Confidence
Inflammatory bowel disease 142 3.015 1.5

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -4.200 0.000
osteosarcoma -2.978 0.000
non-small cell lung carcinoma -1.500 0.000
lung cancer -3.600 0.000
active Crohn's disease 1.057 0.004
interstitial cystitis 1.500 0.000
lung adenocarcinoma -1.600 0.000
lung carcinoma -2.500 0.000
ulcerative colitis 1.200 0.001
pituitary cancer -1.100 0.002

Synonym

Accession Q13478 B2R9Y5 Q52LC9 IL-18R-1
Symbols CD218a
IL18RA
IL1RRP
CDw218a
IL-1Rrp

Gene

PDB

3WO3   3WO4   4R6U  

  Ortholog (9)

Gene RIF (65)

PMID Text
26600055 IL-18 and IL-18R polymorphisms may contribute to the development and lymph node metastasis of PTC.
26561030 strong evidence that IL-18 and IL18Ralpha have important functions in the pathogenesis of allergic asthma
25729923 IL-37 requires the receptors IL-18Ralpha and IL-1R8 to carry out its multifaceted anti-inflammatory program upon innate signal transduction.
25500532 The architecture of the IL-18 receptor second domain (D2) is unique among the other IL-1R family members, which presumably distinguishes them from the IL-1 receptors that exhibit a more promiscuous ligand recognition mode.
25360588 polymorphisms in the interleukin 18 receptor 1 gene and tuberculosis susceptibility among Chinese
25327457 PDGFB and IL18R1 represent plausible candidates for studying the pathophysiology of these disorders in the context of TLR4 activation
25269704 Human memory IL-18Ralpha and DR3 CD4+ T cells may contribute to antigen-independent innate responses at barrier surfaces.
25261253 structural basis for the specific recognition of IL-18 by its alpha receptor
25170117 IL-18R downregulates IFN-alpha production by activation-induced splicing of IL-18Ralpha into 2 isoforms: the full-length receptor (IL-18Ralpha1) and a novel, truncated variant (IL-18Ralpha2), a competitive molecular decoy inhibiting canonical IL-18Ralpha1/IL-18Rbeta signaling.
24963217 IL-18, IL-18BP, and IL-18R may have roles in the pathogenesis of epithelial ovarian carcinoma
More...

AA Sequence

MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNP      1 - 70
RSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFTERQVTSKIVEVKKFFQITC     71 - 140
ENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFNITKTFNITIVEDR    141 - 210
SNIVPVLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASK    211 - 280
VLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVI    281 - 350
YRVDLVLFYRHLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV    351 - 420
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVTDFTFLPQSLK    421 - 490
LLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSES                       491 - 541
//

Text Mined References (81)

PMID Year Title
26600055 2015 Single Nucleotide Polymorphism of Interleukin-18 and Interleukin-18 Receptor and the Risk of Papillary Thyroid Cancer.
26561030 2015 Allergic airway inflammation: unravelling the relationship between IL-37, IL-18R? and Tir8/SIGIRR.
25729923 2015 IL-37 requires the receptors IL-18R? and IL-1R8 (SIGIRR) to carry out its multifaceted anti-inflammatory program upon innate signal transduction.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25500532 2014 The structural basis for receptor recognition of human interleukin-18.
25360588 2014 Polymorphisms in the interleukin 18 receptor 1 gene and tuberculosis susceptibility among Chinese.
25327457 2014 Characterizing the genetic basis of innate immune response in TLR4-activated human monocytes.
25269704 2015 A major population of mucosal memory CD4+ T cells, coexpressing IL-18R? and DR3, display innate lymphocyte functionality.
25261253 2014 Structural basis for the specific recognition of IL-18 by its alpha receptor.
25250214 2014 Identification of a truncated splice variant of IL-18 receptor alpha in the human and rat, with evidence of wider evolutionary conservation.
More...