Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.43
PubTator Score 18.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -3.100 6.0e-08
ependymoma -1.600 7.2e-03
glioblastoma -1.100 2.5e-02
group 3 medulloblastoma -3.300 6.9e-03
medulloblastoma, large-cell -2.900 3.9e-03
osteosarcoma 1.131 1.4e-03
pediatric high grade glioma -1.400 3.9e-02
Pick disease -1.200 5.6e-03
primitive neuroectodermal tumor -1.900 3.9e-02
psoriasis -1.300 4.1e-27

Gene RIF (1)

AA Sequence

MQPMVMQGCPYTLPRCHDWQAADQFHHSSSLRSTCPHPQVRAAVTSPAPPQDGAGVPCLSLKLLNGSVGA      1 - 70
SGPLEPPAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQKDEELSAQLPLQGDVALVQQ     71 - 140
EKETHAAFMEEVKSRGPYIYSVLESAQAFLSQHPFEELEEPHSESKDTSPKQRIQNLSRFVWKQATVASE    141 - 210
LWEKLTARCVDQHRHIERTLEQLLEIQGAMEELSTTLSQAEGVRATWEPIGDLFIDSLPEHIQAIKLFKE    211 - 280
EFSPMKDGVKLVNDLAHQLAISDVHLSMENSQALEQINVRWKQLQASVSERLKQLQDAHRDFGPGSQHFL    281 - 350
SSSVQVPWERAISPNKVPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDL    351 - 420
VTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLLNVFDSGRSGK    421 - 490
MRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEAIQVPRQLGEVAAFGGSNVEPSV    491 - 560
RSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVTIAEQVKHQTKCSICRQCPIKGFRYRSLKQFN    561 - 630
VDICQTCFLTGRASKGNKLHYPIMEYYTPTTSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEA    631 - 700
DYSETPASSPMWPHADTHSRIEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDREPAFG    701 - 770
QQAPCSVATESKGELQKILAHLEDENRILQGELRRLKWQHEEAAEAPSLADGSTEAATDHRNEELLAEAR    771 - 840
ILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPTESDGSGSAGSSLASSPQQSEGSHPREKGQTT    841 - 910
PDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS                           911 - 957
//

Text Mined References (10)

PMID Year Title