Property Summary

NCBI Gene PubMed Count 30
Grant Count 158
R01 Count 64
Funding $37,564,393.7
PubMed Score 484.41
PubTator Score 49.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis -1.300 0.018
osteosarcoma -1.502 0.000

Synonym

Accession Q13472 A8KA61 B4DK80 D3DXC7 Q13473
Symbols TOP3
ZGRF7

Gene

PANTHER Protein Class (1)

PDB

4CGY   4CHT  

Gene RIF (16)

PMID Text
25200081 The results show that Topo IIIalpha stimulates DNA unwinding by BLM in a manner that is potentiated by RMI1-RMI2, and that the processivity of resection is reliant on the Topo IIIalpha-RMI1-RMI2 complex.
24526736 hTOP3alpha interacts with p53, regulates p53 and p21 expression, and contributes to the p53-mediated tumor suppression
24108125 MPS1 protein-dependent phosphorylation of RecQ-mediated genome instability protein 2 (RMI2) at serine 112 is essential for BLM-Topo III alpha-RMI1-RMI2 (BTR) protein complex function upon spindle assembly checkpoint (SAC) activation during mitosis
22672768 Study found a correlation between topoisomerase IIIalpha immunoexpression and oral squamous cell carcinoma (OSCC) cancer stem cell immunophenotypes. However, results did not show a prognostic significance of topoisomerases in OSCC>
22050635 TOP3A, a new partner gene fused to MLL in an adult patient with de novo acute myeloid leukaemia.
20445207 human topoisomerase IIIalpha functions as a decatenase with the assistance of BLM and RMI1 to facilitate the processing of homologous recombination intermediates without crossing over as a mechanism to preserve genome integrity
19742304 G-quadruplex ligand telomestatin impairs binding of topoisomerase IIIalpha to G-quadruplex-forming oligonucleotides and uncaps telomeres in ALT cells
19432957 Individuals carrying genetic variants of the BLM-TOP3A-RMI1 complex have an increased risk of acute myeloid leukemia/myelodysplatic syndromes, malignant melanoma, bladder and breast cancer.
19432957 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18418389 Topo IIIalpha is an important telomere-associated factor, essential for telomere maintenance and chromosome stability in ALT cells, and speculate on its potential mechanistic function.
More...

AA Sequence

MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRRREGLSKFNKI      1 - 70
YEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEKYCPENFVDIKKTLERETRQC     71 - 140
QALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEITPHAVRTACENLTEPDQRVSDAVDVRQEL    141 - 210
DLRIGAAFTRFQTLRLQRIFPEVLAEQLISYGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGI    211 - 280
VEFNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRI    281 - 350
AEKLYTQGYISYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPT    351 - 420
KYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDVYPYDHWSDKI    421 - 490
LPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTPDKRFL    491 - 560
PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEA    561 - 630
LAQYFGNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASR    631 - 700
DSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQ    701 - 770
SLNRMDNSQHPQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNG    771 - 840
GSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQK    841 - 910
DGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLESEARSKRPRASSSDMGSTAKK    911 - 980
PRKCSLCHQPGHTRPFCPQNR                                                     981 - 1001
//

Text Mined References (36)

PMID Year Title
25200081 2014 Multifaceted role of the Topo III?-RMI1-RMI2 complex and DNA2 in the BLM-dependent pathway of DNA break end resection.
24526736 2014 DNA topoisomerase III alpha regulates p53-mediated tumor suppression.
24108125 2013 Monopolar spindle 1 (MPS1) protein-dependent phosphorylation of RecQ-mediated genome instability protein 2 (RMI2) at serine 112 is essential for BLM-Topo III ?-RMI1-RMI2 (BTR) protein complex function upon spindle assembly checkpoint (SAC) activation during mitosis.
23509288 2013 Scaffolding protein SPIDR/KIAA0146 connects the Bloom syndrome helicase with homologous recombination repair.
22672768 2012 Topoisomerase expression in oral squamous cell carcinoma: relationship with cancer stem cells profiles and lymph node metastasis.
22050635 2012 TOP3A, a new partner gene fused to MLL in an adult patient with de novo acute myeloid leukaemia.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20445207 2010 Human topoisomerase IIIalpha is a single-stranded DNA decatenase that is stimulated by BLM and RMI1.
19742304 2009 The G-quadruplex ligand telomestatin impairs binding of topoisomerase IIIalpha to G-quadruplex-forming oligonucleotides and uncaps telomeres in ALT cells.
19432957 2009 Association between polymorphisms in RMI1, TOP3A, and BLM and risk of cancer, a case-control study.
More...