Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
R01 Count 1
Funding $735,635.33
PubMed Score 7.19
PubTator Score 8.18

Knowledge Summary

Patent (2,749)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.001
non primary Sjogren syndrome sicca 1.300 0.014

Synonym

Accession Q13470 O95364 Q8IYI4
Symbols

Gene

 Grant Application (2)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
24449862 The activated TNK1 potentiates JAK-STAT signaling through dual phosphorylation of STAT1 at tyrosine 701 and serine 727 amino acid positions.
21536687 The application of functional genomics by using high-throughput-RNAi screens has allowed us to identify TNK1 as a growth-associated kinase in pancreatic cancer cells.
20574532 Observational study of gene-disease association. (HuGE Navigator)
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20413850 Observational study of gene-disease association. (HuGE Navigator)
20090780 Activated Tnk1 kinase is associated with Hodgkin's lymphoma.
18976975 Knockdown of tyrosine kinase, non-receptor, 1 (TNK1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18830724 Meta-analysis of gene-disease association. (HuGE Navigator)
17471239 TNK1 therefore acts as a novel molecular switch that can determine the properties of TNFalpha signaling and therefore cell death.

AA Sequence

MLPEAGSLWLLKLLRDIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLSEALKRLRSGP      1 - 70
KSKNWVYKILGGFAPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGELLGSGCFGVVHRGLWTLPSG     71 - 140
KSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHVLRLHGLVLGQPLQMVMELAPLGSLHARLTA    141 - 210
PAPTPPLLVALLCLFLRQLAGAMAYLGARGLVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMG    211 - 280
GPRPIPYAWCAPESLRHGAFSSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSR    281 - 350
ALYSLALRCWAPHPADRPSFSHLEGLLQEAGPSEACCVRDVTEPGALRMETGDPITVIEGSSSFHSPDST    351 - 420
IWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRN    421 - 490
MPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRPPLSSSSPQPSQPSRERLPWP    491 - 560
KRKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEVELSVHGVTHQECQTALGATGGDVVSAIRNLKV    561 - 630
DQLFHLSSRSRADCWRILEHYQWDLSAASRYVLARP                                      631 - 666
//

Text Mined References (26)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24449862 2014 Novel antiviral host factor, TNK1, regulates IFN signaling through serine phosphorylation of STAT1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21536687 2011 High-throughput RNAi screening identifies a role for TNK1 in growth and survival of pancreatic cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20413850 2010 Systematic analysis of candidate genes for Alzheimer's disease in a French, genome-wide association study.
20090780 2010 Identification of activated Tnk1 kinase in Hodgkin's lymphoma.
More...