Property Summary

Ligand Count 6
NCBI Gene PubMed Count 16
PubMed Score 7.71
PubTator Score 8.18

Knowledge Summary

Patent (2,749)


  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 9.9e-04
non primary Sjogren syndrome sicca 891 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 3.1 1.5


  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 9.9e-04
non primary Sjogren syndrome sicca 1.300 1.4e-02

Gene RIF (9)

AA Sequence

DQLFHLSSRSRADCWRILEHYQWDLSAASRYVLARP                                      631 - 666

Text Mined References (26)

PMID Year Title