Property Summary

NCBI Gene PubMed Count 162
Grant Count 132
R01 Count 87
Funding $13,724,112.72
PubMed Score 241.57
PubTator Score 189.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.559 0.000
posterior fossa group B ependymoma 2.100 0.000
non-small cell lung cancer -1.063 0.000
interstitial cystitis 1.400 0.000
group 4 medulloblastoma -1.200 0.006
subependymal giant cell astrocytoma 2.121 0.002
Breast cancer -2.300 0.000
ulcerative colitis 1.300 0.003

Gene

PANTHER Protein Class (1)

PDB

1A02   1OWR   1P7H   1PZU   1S9K   2AS5   2O93   3QRF  

Gene RIF (132)

PMID Text
26903518 Up-regulation of Store-operated Ca2+ Entry and Nuclear Factor of Activated T Cells Promote the Acinar Phenotype of the Primary Human Salivary Gland Cells.
26527057 Data indicate that RNA interference of NFAT isoforms NFATc1, NFATc2, NFATc3 and NFATc4 regulate gene expression differentially in human retinal microvascular endothelial cells (HRMEC).
26374065 two NFAT isoforms (NFAT4 and NFAT1) have shifted band-pass windows for the same receptor in the GPCR signaling pathway
26238508 These data suggest that NFATc2 expression is regulated by intracellular calcium and in vitro stretch, and that the stretch response in human myometrial cells is dependent upon intracellular calcium signalling pathways.
25987655 In multivariate logistic regression, the intronic rs6021191 variant in nuclear factor of activated T cells 2 (NFATC2) had the strongest association with hypersensitivity to asparaginase.
25818645 Results show that two protein isoforms NFAT1 and NFAT4 are both cytosolic and stimulated by the same Ca2+ messenger but require distinct subcellular Ca2+ signals for activity.
25797200 inhibits CCR7 expression during the course of dendritic cell maturation
25735562 NFAT1-mediated IL8 production promotes the migration of primary human neutrophils in vitro and also promotes neutrophil infiltration in tumor xenografts
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
More...

AA Sequence

MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLK      1 - 70
PYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQP     71 - 140
PLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPA    141 - 210
HYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPS    211 - 280
SHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVE    281 - 350
FLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH    351 - 420
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYE    421 - 490
KIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL    491 - 560
QTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDK    561 - 630
DKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHG    631 - 700
GLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPAL    701 - 770
MAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG    771 - 840
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE    841 - 910
IIRKEFSGPPARNQT                                                           911 - 925
//

Text Mined References (169)

PMID Year Title
26903518 2016 Up-regulation of Store-operated Ca2+ Entry and Nuclear Factor of Activated T Cells Promote the Acinar Phenotype of the Primary Human Salivary Gland Cells.
26766444 2016 Endothelial RSPO3 Controls Vascular Stability and Pruning through Non-canonical WNT/Ca(2+)/NFAT Signaling.
26527057 2015 NFAT isoforms play distinct roles in TNF?-induced retinal leukostasis.
26374065 2015 Band-pass processing in a GPCR signaling pathway selects for NFAT transcription factor activation.
26238508 2015 Nuclear factor of activated T-cell isoform expression and regulation in human myometrium.
25987655 2015 Genome-wide analysis links NFATC2 with asparaginase hypersensitivity.
25818645 2015 Distinct spatial Ca2+ signatures selectively activate different NFAT transcription factor isoforms.
25797200 2015 NFAT-1, Sp-1, Sp-3, and miR-21: New regulators of chemokine C receptor 7 expression in mature human dendritic cells.
25735562 2015 NFAT1 promotes intratumoral neutrophil infiltration by regulating IL8 expression in breast cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
More...