Property Summary

NCBI Gene PubMed Count 40
Grant Count 23
R01 Count 12
Funding $3,257,653.46
PubMed Score 28.90
PubTator Score 24.85

Knowledge Summary

Patent (7,363)

Expression

Gene RIF (19)

PMID Text
25861751 restoring miR-124 may function as a promising strategy to overcome P-gp-mediated MDR by inhibiting FZD5/PKC signaling.
25240054 Wnt5a secreted by monocytes signals through the noncanonical Wnt-FZD5 pathway in mECs to induce TF expression that induces angiogenesis by autocrine regulation.
24993822 data (i) support previous the assumption that CK1 acts via phosphorylation of distinct residues as the activator as well as the shut-off signal of Wnt/beta-catenin signaling and (ii) suggest that CK1 acts on Dvl via different mechanism than Fzd5
24706725 we demonstrate that innate immune functions of macrophages ensue at least partly through a homeostatic Wnt5a-Fz5-NF-kappaB (p65) circuit, which is Rac1 dependent.
23610556 Gcm1 and Fzd5 function in an evolutionary conserved positive feedback loop that regulates trophoblast differentiation and sites of chorionic branching morphogenesis.
23337955 FZD5 was downregulated and reduced the synthesis of membrane transport protein in the hepatic membrane and the membrane stability, and accelerated the liver cell apoptosis process in alcoholic liver disease.
21344486 Several members of the WNT pathway, including WNT5A, FZD5, and DKK1 were highly up-regulated in PCa tissue from patients with advanced PCa.
20525402 Observational study of gene-disease association. (HuGE Navigator)
19643732 Studies identify CVAK104 as a novel binding partner of Dishevelled (Dvl) and that CVAK104 also interacts with Fzd5.
19543507 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQF      1 - 70
WPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLG     71 - 140
RDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKV    141 - 210
RTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLC    211 - 280
VSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGN    281 - 350
EAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL    351 - 420
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHD    421 - 490
TGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEAS    491 - 560
AALTGRTGPPGPAATYHKQVSLSHV                                                 561 - 585
//

Text Mined References (42)

PMID Year Title
25861751 2015 miR-124 represses FZD5 to attenuate P-glycoprotein-mediated chemo-resistance in renal cell carcinoma.
25240054 2014 Monocyte-secreted Wnt5a interacts with FZD5 in microvascular endothelial cells and induces angiogenesis through tissue factor signaling.
24993822 2014 Functional analysis of dishevelled-3 phosphorylation identifies distinct mechanisms driven by casein kinase 1? and frizzled5.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24706725 2014 Wnt5a-Rac1-NF-?B homeostatic circuitry sustains innate immune functions in macrophages.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
24080158 2014 Secreted Frizzled-related protein potentiation versus inhibition of Wnt3a/?-catenin signaling.
23610556 2013 A positive feedback loop involving Gcm1 and Fzd5 directs chorionic branching morphogenesis in the placenta.
23337955 2013 Analysis of differentially expressed genes and microRNAs in alcoholic liver disease.
22895187 2012 Tumour suppressor RNF43 is a stem-cell E3 ligase that induces endocytosis of Wnt receptors.
More...