Property Summary

NCBI Gene PubMed Count 46
PubMed Score 30.55
PubTator Score 24.85

Knowledge Summary

Patent (7,363)

Expression

  Differential Expression (24)

Protein-protein Interaction (1)

Gene RIF (22)

AA Sequence

MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQF      1 - 70
WPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLG     71 - 140
RDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKV    141 - 210
RTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLC    211 - 280
VSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGN    281 - 350
EAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL    351 - 420
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHD    421 - 490
TGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEAS    491 - 560
AALTGRTGPPGPAATYHKQVSLSHV                                                 561 - 585
//

Text Mined References (48)

PMID Year Title