Property Summary

NCBI Gene PubMed Count 124
PubMed Score 115.20
PubTator Score 231.85

Knowledge Summary

Patent

No data available

Synonym

Accession Q13465 Q13466 Q6FH90
Symbols EVI1
MDS1
KMT8E
PRDM3
RUSAT2
MDS1-EVI1
AML1-EVI-1

Gene

Gene RIF (96)

PMID Text
26935937 Isochromosome 3q, especially MECOM abnormality, could play a key role in Persistent polyclonal binucleated B-cell lymphocytosis.
26815134 involvement of MECOM in patients with acute myeloid leukemia and myelodysplastic syndrome with various 3q abnormalities
26729571 EVI1 overexpression has been revealed as an important independent adverse prognostic marker in adult acute myeloid leukemia and defines distinct risk categories in 11q23-rearranged AML.
26674644 RUNX1-Evi-1 may promote proliferation and apoptosis resistance of primitive hematopoietic cell, and inhibit the differentiation of myeloid cells with the synergy of different pathways and factors.
26581901 Mutations in MECOM cause radioulnar synostosis with amegakaryocytic thrombocytopenia.
26554871 MECOM deletion is associated with congenital thrombocytopenia.
26467814 A RT-qPCR assay was used to quantify EVI1 expression covering the different splice variants in bone marrow and blood in AML. EVI1 expression levels significantly decreased between diagnostic and post-induction samples.
25959919 EVI1 antagonizes TGF-beta-mediated growth inhibition of hepatocllular carcinoma cells.
25936528 Low EVI1 expression is associated with chronic lymphocytic leukemia.
25886616 Our data reveal MS4A3 as a novel direct target of EVI1 in human myeloid cells, and show that its repression plays a role in EVI1 mediated tumor aggressiveness.
More...

AA Sequence

MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYI      1 - 70
PDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWL     71 - 140
YLGKRSSDVGIAFSQADVYMPGLQCAFLS                                             141 - 169
//

Text Mined References (124)

PMID Year Title
26935937 2016 Persistent polyclonal binucleated B-cell lymphocytosis and MECOM gene amplification.
26815134 2016 Complex chromosomal rearrangements leading to MECOM overexpression are recurrent in myeloid malignancies with various 3q abnormalities.
26729571 2016 Review: Aberrant EVI1 expression in acute myeloid leukaemia.
26674644 2015 RUNX1-Evi-1 fusion gene inhibited differentiation and apoptosis in myelopoiesis: an in vivo study.
26581901 2015 Mutations in MECOM, Encoding Oncoprotein EVI1, Cause Radioulnar Synostosis with Amegakaryocytic Thrombocytopenia.
26554871 2016 Congenital thrombocytopenia in a neonate with an interstitial microdeletion of 3q26.2q26.31.
26467814 2015 Quantification of EVI1 transcript levels in acute myeloid leukemia by RT-qPCR analysis: A study by the ALFA Group.
25959919 2015 EVI1, a target gene for amplification at 3q26, antagonizes transforming growth factor-?-mediated growth inhibition in hepatocellular carcinoma.
25936528 2015 The regulatory interaction of EVI1 with the TCL1A oncogene impacts cell survival and clinical outcome in CLL.
25886616 2015 EVI1 promotes tumor growth via transcriptional repression of MS4A3.
More...