Property Summary

NCBI Gene PubMed Count 136
PubMed Score 124.52
PubTator Score 231.85

Knowledge Summary

Patent

No data available

Synonym

Accession Q13465 Q13466 Q6FH90
Symbols EVI1
MDS1
KMT8E
PRDM3
RUSAT2
MDS1-EVI1
AML1-EVI-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (108)

AA Sequence

MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYI      1 - 70
PDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWL     71 - 140
YLGKRSSDVGIAFSQADVYMPGLQCAFLS                                             141 - 169
//

Text Mined References (137)

PMID Year Title