Property Summary

NCBI Gene PubMed Count 136
PubMed Score 124.52
PubTator Score 231.85

Knowledge Summary

Patent

No data available

Gene RIF (108)

AA Sequence

MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYI      1 - 70
PDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWL     71 - 140
YLGKRSSDVGIAFSQADVYMPGLQCAFLS                                             141 - 169
//

Text Mined References (137)

PMID Year Title