Property Summary

NCBI Gene PubMed Count 305
Grant Count 170
R01 Count 133
Funding $22,997,113.47
PubMed Score 344.39
PubTator Score 295.46

Knowledge Summary

Patent (15,449)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.606 0.000
adult high grade glioma -1.200 0.000

Synonym

Accession Q13464 B0YJ91 Q2KHM4 Q59GZ4
Symbols ROCK-I
P160ROCK

Gene

PDB

1S1C   2ESM   2ETK   2ETR   2V55   3D9V   3NCZ   3NDM   3O0Z   3TV7   3TWJ   3V8S   4L2W   4W7P   4YVC   4YVE   5BML  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (255)

PMID Text
27160703 New light on the role of the ROCK pathway during early stages of human neurogenesis.
27028892 Galectin-9 stimulated migration in human NK-92 cells by affecting F-actin polarization through the Rho/ROCK1 signaling pathway.
26970302 These findings suggested that miR-198 may act not only as a novel prognostic marker, but also as a potential target for molecular therapy of osteosarcoma.
26928204 Uniaxial stretch activates JNK1 via RhoA and ROCK pathways in human bladder smooth muscle cells.
26872982 Increased ROCK activity was found in chronic kidney disease patients with left ventricular hypertrophy.
26826790 ROCK1 and ROCK2 differentially regulate invadopodia activity through separate signaling pathways.
26818518 This study report that protein levels of the Rho-associated protein kinases (ROCK1) was increased in Progressive Supranuclear Palsy and Corticobasal Degeneration brains.
26715733 High ROCK1 expression is associated with glioma.
26562026 the ROCK1 rs35996865 G variant allele was significantly more frequent in male colorectal cancer (CRC) patients (p = 0.028) than in the control group; finding points to a possible gender-related modulation by the ROCK1 gene in CRC susceptibility
26530325 miR148b directly targets Rhoassociated protein kinase 1 in hepatocellular carcinoma.
More...

AA Sequence

MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLR      1 - 70
MKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLF     71 - 140
YAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSG    141 - 210
HLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYA    211 - 280
DSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRD    281 - 350
TVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA    351 - 420
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKML    421 - 490
LQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKLSQLQKQLEEANDLLRTESDT    491 - 560
AVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDYYQLQAILEAERRDRGHDSEMIGDLQAR    561 - 630
ITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTD    631 - 700
KHQSIEEAKSVAMCEMEKKLKEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVK    701 - 770
NLTLQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR    771 - 840
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLE    841 - 910
EQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEE    911 - 980
ISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQ    981 - 1050
MVVKHQKELNDMQAQLVEECAHRNELQMQLASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESR   1051 - 1120
IEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETE   1121 - 1190
EIPKIFQILYANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE   1191 - 1260
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSGFVRASPR   1261 - 1330
TLSTRSTANQSFRKVVKNTSGKTS                                                 1331 - 1354
//

Text Mined References (319)

PMID Year Title
27160703 2016 Rho Kinase Inhibition Is Essential During In Vitro Neurogenesis and Promotes Phenotypic Rescue of Human Induced Pluripotent Stem Cell-Derived Neurons With Oligophrenin-1 Loss of Function.
27028892 2016 Reduced Expression of Galectin-9 Contributes to a Poor Outcome in Colon Cancer by Inhibiting NK Cell Chemotaxis Partially through the Rho/ROCK1 Signaling Pathway.
26970302 2016 MicroRNA-198 inhibited tumorous behaviors of human osteosarcoma through directly targeting ROCK1.
26928204 2016 Uni-axial stretch induces actin stress fiber reorganization and activates c-Jun NH2 terminal kinase via RhoA and Rho kinase in human bladder smooth muscle cells.
26872982 2016 Increased rho kinase activity in mononuclear cells of dialysis and stage 3-4 chronic kidney disease patients with left ventricular hypertrophy: Cardiovascular risk implications.
26826790 2016 Matrix rigidity differentially regulates invadopodia activity through ROCK1 and ROCK2.
26818518 2016 Rho Kinase Inhibition as a Therapeutic for Progressive Supranuclear Palsy and Corticobasal Degeneration.
26715733 2016 MicroRNA-584-3p, a novel tumor suppressor and prognostic marker, reduces the migration and invasion of human glioma cells by targeting hypoxia-induced ROCK1.
26562026 2015 Possible Gender-Related Modulation by the ROCK1 Gene in Colorectal Cancer Susceptibility.
26530325 2016 MicroRNA-148b targets Rho-associated protein kinase 1 to inhibit cell proliferation, migration and invasion in hepatocellular carcinoma.
More...