Property Summary

NCBI Gene PubMed Count 25
PubMed Score 31.54
PubTator Score 29.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

Gene RIF (16)

AA Sequence

MAGRSDMDPPAAFSGFPALPAVAPSGPPPSPLAGAEPGREPEEAAAGRGEAAPTPAPGPGRRRRRPLQRG      1 - 70
KPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPREPGNPG     71 - 140
KGNYWTLDPAAADMFDNGSFLRRRKRFKRAELPAHAAAAPGPPLPFPYAPYAPAPGPALLVPPPSAGPGP    141 - 210
SPPARLFSVDSLVNLQPELAGLGAPEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGP    211 - 280
LPAEPLLALAGPAAALGPLSPGEAYLRQPGFASGLERYL                                   281 - 319
//

Text Mined References (23)

PMID Year Title