Property Summary

NCBI Gene PubMed Count 51
Grant Count 15
R01 Count 8
Funding $1,973,458.59
PubMed Score 54.66
PubTator Score 63.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.486 0.000
glioblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
primitive neuroectodermal tumor 1.100 0.002
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.100 0.000
lung carcinoma -1.100 0.000

Gene RIF (50)

PMID Text
26529257 newly defined SLIT/ROBO/Myo9b/RhoA signaling pathway that restricts lung cancer progression and metastasis.
25710847 Results does not support the association of MYO9B with schizophrenia in Chinese population.
25098938 Our data suggest a link between MYO9B variants to an increased intestinal permeability in Crohn's disease patients.
24966617 MYO9B SNPs may influence the sub-phenotypic expression of Crohn's disease but did not find an association between these MYO9B polymorphisms and intestinal permeability in IBD.
24386489 Variants in MYO9B may be involved in acute pancreatitis
23368647 genetic variation MYO9B gene is associated with celiac disease as a protective or a risk factor
22954106 The homozygous G/G group of theMyo9B polymorphism was associated with an increased risk for Barrett's esophagus and esophageal adenocarcinoms (EAC) development. Also the heterozygous A/G genotype was associated with an increased risk for EAC development.
22573889 critical roles for Myo9b during epithelial wound healing and maintenance of tight junction integrity-key functions that may be altered in patients with Myo9b-linked inflammatory bowel disease.
21688385 we performed genetic analysis of the MYO9B gene and the IL-2/IL-21 locus by genotyping SNPs that have been previously associated with coeliac disease or schizophrenia found no evidence for association with these two loci.
21515326 These data demonstrate an association of MYO9B with ileal CD.
More...

AA Sequence

MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKDAIASLRLDGTKCYVLVEVKE      1 - 70
SGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKYVHMQLVAQATATRRLVERGL     71 - 140
LPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAGSILVAINPFKFLPIYNPKYVKMYENQQLGK    141 - 210
LEPHVFALADVAYYTMLRKRVNQCIVISGESGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLE    211 - 280
AFGNAKTAHNNNSSRFGKFIQVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEER    281 - 350
QEFQLKQPEDYFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRA    351 - 420
TGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDSMAKSLYSALF    421 - 490
DWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYANEQLQYYFNQHIFKLEQEEY    491 - 560
QGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFPHATSQTLLAKFKQQHEDNKYFLGTPVMEPA    561 - 630
FIIQHFAGKVKYQIKDFREKNMDYMRPDIVALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLRE    631 - 700
AGRLRAERAEKAAGMSSPGAQSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRL    701 - 770
QKPRAFILKSKGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE    771 - 840
ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTEQFQVLLPKDA    841 - 910
QPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKILLLQSWFRMVLERRHFLQMK    911 - 980
RAAVTIQACWRSYRVRRALERTQAAVYLQASWRGYWQRKLYRHQKQSIIRLQSLCRGHLQRKSFSQMISE    981 - 1050
KQKAEEKEREALEAARAGAEEGGQGQAAGGQQVAEQGPEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEA   1051 - 1120
PSPEKTLPPQKTVAAESHEKVPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSL   1121 - 1190
LEDKKESREDETLLVVETEAENTSQKQPTEQPQAMAVGKVSEETEKTLPSGSPRPGQLERPTSLALDSRV   1191 - 1260
SPPAPGSAPETPEDKSKPCGSPRVQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVAAASPSAMLSQ   1261 - 1330
SLDLSDRHRATGAALTPTEERRTSFSTSDVSKLLPSLAKAQPAAETTDGERSAKKPAVQKKKPGDASSLP   1331 - 1400
DAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENAVSGHVVLEATTMKKGLEAPSGQQHRHAAGE   1401 - 1470
KRTKEPGGKGKKNRNVKIGKITVSEKWRESVFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEAT   1471 - 1540
EKFRSNIKTMYSVPNGKIHVGYKDLMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEP   1541 - 1610
VKQSKAQKKKRKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSH   1611 - 1680
CSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQAL   1681 - 1750
QTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIYAVLEHLPEANHN   1751 - 1820
SLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKV   1821 - 1890
KMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDED   1891 - 1960
REKEILIERIQSIKEEKEDITYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPALPCPG   1961 - 2030
APTPSPLPTVAAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPP   2031 - 2100
ARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQTNG                2101 - 2157
//

Text Mined References (67)

PMID Year Title
26529257 2015 Myo9b is a key player in SLIT/ROBO-mediated lung tumor suppression.
25710847 2015 Lack of genetic association between the MYO9B locus and schizophrenia in a Chinese population.
25098938 2014 Myosin IXb variants and their pivotal role in maintaining the intestinal barrier: a study in Crohn's disease.
24966617 2014 Association of MYO9B gene polymorphisms with inflammatory bowel disease in Chinese Han population.
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24386489 2013 Association analysis of genetic variants in the myosin IXB gene in acute pancreatitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23368647 2012 Frequency of MYO9B polymorphisms in celiac patients and controls.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22954106 2012 Myo9B is associated with an increased risk of Barrett's esophagus and esophageal adenocarcinoma.
More...