Property Summary

NCBI Gene PubMed Count 33
Grant Count 7
R01 Count 5
Funding $458,318.26
PubMed Score 72.82
PubTator Score 65.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.600 0.003
oligodendroglioma -1.200 0.006
psoriasis 1.100 0.001
glioblastoma multiforme -1.600 0.000
osteosarcoma 1.639 0.028
atypical teratoid/rhabdoid tumor 1.500 0.000
Duchenne muscular dystrophy 1.182 0.000
intraductal papillary-mucinous adenoma (... -2.300 0.000
lung cancer 2.800 0.000
Breast cancer 2.800 0.031
interstitial cystitis -2.000 0.000
adult high grade glioma -2.300 0.000
aldosterone-producing adenoma -1.144 0.022
subependymal giant cell astrocytoma -1.274 0.037
lung carcinoma 1.400 0.000
Pick disease -1.600 0.002
ulcerative colitis 1.500 0.029
ovarian cancer -2.200 0.000

Synonym

Accession Q13454 A8MSM0 D3DSP2 Q14911 Q14912 Q96FW0
Symbols M33
N33
MRT7
MRT22
OST3A
D8S1992

Gene

PANTHER Protein Class (2)

PDB

4M8G   4M90   4M91   4M92  

Gene RIF (18)

PMID Text
26871953 decreased immunological TUSC3 staining is a factor prognostic of poor survival in pancreatic cancer patients.
26427135 Report frequencies of short tandem repeat markers linked to TUSC3 (MRT7) or NSUN2 (MRT5) genes used for homozygosity mapping of recessive intellectual disability.
25966277 The TUSC3 gene is associated with mental retardation in the Qinba mountain area in China; the sixth exon of the TUSC3 gene may contribute to the risk of developing the disease.
25735931 Loss of TUSC3 alters the molecular response to endoplasmic reticulum stress.
25086101 IGFII and N33 methylation status may be related to gastric carcinogenesis.
24685145 TUSC3 increases glycosylation efficiency for a subset of human glycoproteins by slowing glycoprotein folding.
24435307 TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo
23825019 Homozygous deletion in TUSC3 causes syndromic intellectual disability.
23404293 TUSC3 is a tumor suppressor gene in ovarian cancer.
21739581 A novel nonsense mutation in TUSC3 is responsible for non-syndromic autosomal recessive mental retardation
More...

AA Sequence

MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNG      1 - 70
DKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVF     71 - 140
QQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSL    141 - 210
VGGLLYLRRNNLEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAE    211 - 280
SHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE      281 - 348
//

Text Mined References (34)

PMID Year Title
26871953 2016 Decreased TUSC3 Promotes Pancreatic Cancer Proliferation, Invasion and Metastasis.
26427135 2015 Frequencies of Six (Five Novel) STR Markers Linked to TUSC3 (MRT7) or NSUN2 (MRT5) Genes Used for Homozygosity Mapping of Recessive Intellectual Disability.
25966277 2015 Association of TUSC3 gene polymorphisms with non-syndromic mental retardation based on nuclear families in the Qinba mountain area of China.
25735931 2015 Tumor suppressor candidate 3 (TUSC3) prevents the epithelial-to-mesenchymal transition and inhibits tumor growth by modulating the endoplasmic reticulum stress response in ovarian cancer cells.
25086101 2014 Methylation status of blood leukocyte DNA and risk of gastric cancer in a high-risk Chinese population.
24685145 2014 Structural basis of substrate specificity of human oligosaccharyl transferase subunit N33/Tusc3 and its role in regulating protein N-glycosylation.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24435307 2014 TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo.
23825019 2013 Homozygous deletion in TUSC3 causing syndromic intellectual disability: a new patient.
23594818 2013 Evidence for shared genetic risk between methamphetamine-induced psychosis and schizophrenia.
More...