Property Summary

NCBI Gene PubMed Count 38
PubMed Score 81.53
PubTator Score 65.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.300 2.6e-04
aldosterone-producing adenoma -1.144 2.2e-02
astrocytic glioma -1.600 2.6e-03
atypical teratoid / rhabdoid tumor 1.100 2.0e-03
Breast cancer 2.600 3.1e-02
Duchenne muscular dystrophy 1.182 2.4e-08
glioblastoma -1.200 1.7e-02
interstitial cystitis -2.000 4.5e-04
intraductal papillary-mucinous adenoma (... -1.400 1.3e-02
lung cancer 1.100 4.6e-02
lung carcinoma 1.400 6.3e-15
oligodendroglioma -1.200 5.8e-03
osteosarcoma 1.639 2.8e-02
ovarian cancer -2.200 4.3e-06
Pick disease -1.100 4.5e-03
psoriasis 1.100 5.2e-04
subependymal giant cell astrocytoma -1.274 3.7e-02
ulcerative colitis 1.500 2.9e-02

Protein-protein Interaction (8)

Gene RIF (23)

AA Sequence

MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNG      1 - 70
DKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVF     71 - 140
QQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSL    141 - 210
VGGLLYLRRNNLEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAE    211 - 280
SHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE      281 - 348
//

Text Mined References (40)

PMID Year Title