Property Summary

NCBI Gene PubMed Count 182
Grant Count 83
R01 Count 30
Funding $7,992,611.17
PubMed Score 308.03
PubTator Score 220.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (50)

Disease Z-score Confidence
post-traumatic stress disorder 45 5.937 3.0
Major Depressive Disorder 106 4.56 2.3
Bipolar Disorder 266 3.765 1.9
Cancer 2,346 3.07 1.5
Atopic dermatitis 944
Duchenne muscular dystrophy 602
Endometriosis 535
Hydrolethalus syndrome 128
Intractable Eczema 5
Liver transplant rejection 5
Neonatal disorder 1
Neurobehavioral Manifestations 5
Pick disease 1,893
Prevention of Cardiac Transplant Rejecti... 14 
Prevention of Kidney Transplant Rejectio... 16 
Prevention of Liver Transplant Rejection 14
Prevention of Transplant Rejection 6
Pulmonary lymphangioleiomyomatosis 5
Renal Cell Carcinoma 199
Renal transplant rejection 13
Rheumatoid Arthritis 1,160
Transplanted organ rejection 10
acute quadriplegic myopathy 1,157
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
chronic rhinosinusitis 512
cystic fibrosis and chronic rhinosinusit... 213 
gastric cancer 430
glioblastoma multiforme 347
group 3 medulloblastoma 2,254
hepatocellular carcinoma 532
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
non primary Sjogren syndrome sicca 840
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group B ependymoma 1,530
psoriasis 6,685
severe asthma 11
tuberculosis and treatment for 6 months 686

Expression

Synonym

Accession Q13451 F5H7R1 Q59EB8 Q5TGM6 PPIase FKBP5
Symbols P54
AIG6
FKBP51
FKBP54
PPIase
Ptg-10

Gene

PANTHER Protein Class (1)

PDB

1KT0   3O5D   3O5E   3O5F   3O5G   3O5I   3O5J   3O5K   3O5L   3O5M   3O5O   3O5P   3O5Q   3O5R   4DRH   4DRI   4DRK   4DRM   4DRN   4DRO   4DRP   4DRQ   4JFI   4JFJ   4JFK   4JFL   4JFM   4R0X   4TW6   4TW7   4TX0   4W9O   4W9P   4W9Q   5BXJ   5DIT   5DIU   5DIV  

Gene RIF (165)

PMID Text
27062383 nicotine is a very important confounder in the modulation of hypothalamic-pituitary-adrenal axis activity by FKBP5, which is regulated by the polymorphism in rs1360780
27038411 FKBP5 regulates glucocorticoid receptor activity and response to stress.
26792730 CsA and FK506 might interfere with selected effector T cell functions via a CrkII-, but not CrkI-dependent mechanisms.
26647360 Genetic variation of FKBP5 has been found to interact with early trauma or childhood adversity to predict negative outcomes later in life.
26630184 Study indicates that genetic alterations in FKBP5 may influence vulnerability to suicide
26602018 the abundance of BDNF positively correlated and phosphorylated DNMT1 inversely correlated with that of FKBP51 in cells
26588823 3 FKBP5 SNPs (rs3800373, rs7753746, and rs9380526) predicted chronic postconcussive symptom severity. Similar effect sizes were observed for the minor alleles of rs7753746 and rs9380526.
26535949 FKBP5 gene methylation may be a mechanism of the biobehavioral effects of adverse exposures in young children.
26535939 Whether a maltreated child will traverse an externalizing pathway toward substance use disorder in adolescence is dependent on FKBP5 genetic variation.
26521051 Results indicate that genetic variation in FKBP5 influences the risk of anxiety and/or depressive disorders in preschool age by altering the sensitivity to the deleterious effects of mild to moderate adverse events
More...

AA Sequence

MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSS      1 - 70
HDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE     71 - 140
DLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQ    141 - 210
REEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFK    211 - 280
GGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSAN    281 - 350
EKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD    351 - 420
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV                                     421 - 457
//

Text Mined References (193)

PMID Year Title
27062383 2016 The Effect of Nicotine on HPA Axis Activity in Females is Modulated by the FKBP5 Genotype.
27038411 2016 STRUCTURAL AND FUNCTIONAL CONNECTIVITY IN POSTTRAUMATIC STRESS DISORDER: ASSOCIATIONS WITH FKBP5.
26792730 2016 In vivo regulation of human CrkII by cyclophilin A and FK506-binding protein.
26647360 2015 HPA AXIS RELATED GENES AND RESPONSE TO PSYCHOLOGICAL THERAPIES: GENETICS AND EPIGENETICS.
26630184 2015 Association between FKBP5 Functional Polymorphisms and Completed Suicide.
26602018 2015 Chaperoning epigenetics: FKBP51 decreases the activity of DNMT1 and mediates epigenetic effects of the antidepressant paroxetine.
26588823 2016 Association of Epidemiologic Factors and Genetic Variants Influencing Hypothalamic-Pituitary-Adrenocortical Axis Function With Postconcussive Symptoms After Minor Motor Vehicle Collision.
26535949 2015 Childhood maltreatment and methylation of FK506 binding protein 5 gene (FKBP5).
26535939 2015 Developmental pathways from child maltreatment to adolescent marijuana dependence: Examining moderation by FK506 binding protein 5 gene (FKBP5).
26521051 2016 FKBP5 polymorphisms moderate the influence of adverse life events on the risk of anxiety and depressive disorders in preschool children.
More...