Property Summary

NCBI Gene PubMed Count 22
Grant Count 34
R01 Count 9
Funding $8,101,938.83
PubMed Score 51.00
PubTator Score 35.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26844274 A novel genomic alteration of LSAMP associates with aggressive prostate cancer in African American men
24885297 The tumor suppressor function of LSAMP is most likely exerted by reducing the proliferation rate of the tumor cells, possibly by indirectly upregulating one or more of the genes HES1, CTAG2 or KLF10.
24491686 The results showed significant allelic and haplotypic associations between LSAMP gene and schizophrenia.
22892717 This study presents the first evidence of a possible role of LSAMP gene in mood and anxiety disorders in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19724913 Identification of chromosomal aberrations associated with disease progression and a novel 3q13.31 deletion involving LSAMP gene in osteosarcoma.
19441093 results show that LSAMP is a novel candidate tumor suppressor gene in osteosarcomas
18433483 LSAMP might play a role in pathoaetiology of suicidal behaviour but further studies are needed to understand its exact contribution
18433483 Observational study of gene-disease association. (HuGE Navigator)
18318786 Single nucleotide polymorphisms of LSAMP is associated with the pathogenesis of coronary artery disease.
More...

AA Sequence

MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGI      1 - 70
IFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSD     71 - 140
VTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQ    141 - 210
VKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNV    211 - 280
TEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC                281 - 338
//

Text Mined References (23)

PMID Year Title
26844274 2015 A novel genomic alteration of LSAMP associates with aggressive prostate cancer in African American men.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24885297 2014 Reexpression of LSAMP inhibits tumor growth in a preclinical osteosarcoma model.
24491686 2014 Associations between polymorphisms of LSAMP gene and schizophrenia.
23532449 2013 Limbic system associated membrane protein as a potential target for neuropsychiatric disorders.
22892717 2012 Associations between LSAMP gene polymorphisms and major depressive disorder and panic disorder.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19724913 2009 Identification of chromosomal aberrations associated with disease progression and a novel 3q13.31 deletion involving LSAMP gene in osteosarcoma.
More...