Property Summary

NCBI Gene PubMed Count 23
PubMed Score 52.78
PubTator Score 35.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.200 3.5e-03
atypical teratoid / rhabdoid tumor -1.100 2.3e-02
ependymoma -1.400 1.1e-04
glioblastoma -1.300 2.7e-03
group 3 medulloblastoma -1.400 9.6e-03
intraductal papillary-mucinous adenoma (... -1.800 1.1e-02
intraductal papillary-mucinous neoplasm ... -1.100 2.3e-02
lung cancer -1.500 4.8e-02
medulloblastoma, large-cell -2.300 5.1e-07
non-small cell lung cancer -1.318 1.7e-12
osteosarcoma 1.185 1.7e-02
ovarian cancer -1.700 6.2e-13
pituitary cancer 2.300 1.2e-06
primary pancreatic ductal adenocarcinoma 1.130 4.1e-03
primary Sjogren syndrome 1.400 2.9e-04

Gene RIF (13)

AA Sequence

MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGI      1 - 70
IFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSD     71 - 140
VTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQ    141 - 210
VKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNV    211 - 280
TEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC                281 - 338
//

Text Mined References (24)

PMID Year Title