Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.74
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.6e-06

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 1.6e-06

 GO Function (1)

Gene RIF (3)

AA Sequence

MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDV      1 - 70
DFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEA     71 - 140
VEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVL    141 - 210
QVCTLKRFFQDKRPVPT                                                         211 - 227
//

Text Mined References (14)

PMID Year Title