Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.74
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 0.000

Synonym

Accession Q13445
Symbols Tp24
p24g1
Il1rl1l
IL1RL1LG

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
23319592 The GOLD domain-containing protein TMED1 is involved in interleukin-33 signaling
18976975 Knockdown of transmembrane emp24 protein transport domain containing 1 (TMED1) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
11466339 ST2L is stably and selectively expressed on human Th2, Tc2 and NK2 lymphocyte lines and can be used as a marker for determining shifts in immune status of human diseases such as HIV infection.

AA Sequence

MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDV      1 - 70
DFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEA     71 - 140
VEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVL    141 - 210
QVCTLKRFFQDKRPVPT                                                         211 - 227
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319592 2013 The GOLD domain-containing protein TMED1 is involved in interleukin-33 signaling.
21269460 2011 Initial characterization of the human central proteome.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...