Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.74
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.58299960887633E-6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 0.000

Synonym

Accession Q13445
Symbols Tp24
p24g1
Il1rl1l
IL1RL1LG

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

 GO Function (1)

Pathway (1)

Gene RIF (3)

PMID Text
23319592 The GOLD domain-containing protein TMED1 is involved in interleukin-33 signaling
18976975 Knockdown of transmembrane emp24 protein transport domain containing 1 (TMED1) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
11466339 ST2L is stably and selectively expressed on human Th2, Tc2 and NK2 lymphocyte lines and can be used as a marker for determining shifts in immune status of human diseases such as HIV infection.

AA Sequence

MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDV      1 - 70
DFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEA     71 - 140
VEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVL    141 - 210
QVCTLKRFFQDKRPVPT                                                         211 - 227
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319592 2013 The GOLD domain-containing protein TMED1 is involved in interleukin-33 signaling.
21269460 2011 Initial characterization of the human central proteome.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...