Property Summary

NCBI Gene PubMed Count 68
Grant Count 29
R01 Count 28
Funding $2,590,239.28
PubMed Score 82.14
PubTator Score 78.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.513 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.006
non-inflammatory breast cancer 1.100 0.011

Gene RIF (51)

PMID Text
26930657 the results revealed an undescribed role of ADAM15 in the invasion of human bladder cancer and suggested that the ADAM15 catalytic domain may represent a viable therapeutic target in patients with advanced disease.
26323669 ADAM15 promotes lung cancer cell invasion through directly targeting MMP9 activation.
25650586 findings indicated that silencing ADAM15 had antiinflammatory effects in FLSs and efficiently inhibited the development of CIA.
25333931 these data suggest the potential role of miR147b in regulating endothelial barrier function by targeting ADAM15 expression.
25208722 present a tumor suppressive mechanism for ADAM15 exosomes and provide insight into the functional significance of exosomes that generate tumor-inhibitory factors
24725932 Knockdown of ADAM metallopeptidase domain 15 (ADAM15) by siRNA inhibits HIV-1 replication in MAGI-CCR5 cells
23918525 ADAM15 contributes to apoptosis resistance in rheumatoid arthritis synovial fibroblasts by activating the Src/FAK pathway upon FasL exposure.
23910172 The severity of intrauterine adhesions positively correlates to the protein and transcript expression levels of ADAM-15 and ADAM-17 in uterine tissue.
23688428 In conclusion, our data identified rhddADAM15 as a potent inhibitor of tumor growth and metastasis, making it a promising tool for use in anticancer treatment.
23365087 ADAM15 acts as a negative regulator of TRIF-mediated NF-kappaB and IFN-beta reporter gene activity via TLR3 and TLR4 signaling.
More...

AA Sequence

MRLALLWALGLLGAGSPLPSWPLPNIGGTEEQQAESEKAPREPLEPQVLQDDLPISLKKVLQTSLPEPLR      1 - 70
IKLELDGDSHILELLQNRELVPGRPTLVWYQPDGTRVVSEGHTLENCCYQGRVRGYAGSWVSICTCSGLR     71 - 140
GLVVLTPERSYTLEQGPGDLQGPPIISRIQDLHLPGHTCALSWRESVHTQKPPEHPLGQRHIRRRRDVVT    141 - 210
ETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVT    211 - 280
LENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHEL    281 - 350
GHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPM    351 - 420
AAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLP    421 - 490
EFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSC    491 - 560
GRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTL    561 - 630
PGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTTGLLL    631 - 700
SLLVLLVLVMLGASYWYRARLHQRLCQLKGPTCQYRAAQSGPSERPGPPQRALLARGTKQASALSFPAPP    701 - 770
SRPLPPDPVSKRLQAELADRPNPPTRPLPADPVVRSPKSQGPAKPPPPRKPLPADPQGRCPSGDLPGPGA    771 - 840
GIPPLVVPSRPAPPPPTVSSLYL                                                   841 - 863
//

Text Mined References (71)

PMID Year Title
26930657 2016 ADAM15 Is Functionally Associated with the Metastatic Progression of Human Bladder Cancer.
26323669 2015 ADAM15 targets MMP9 activity to promote lung cancer cell invasion.
25650586 2015 A disintegrin and metallproteinaseĀ 15 knockout decreases migration of fibroblast-like synoviocytes and inflammation in rheumatoid arthritis.
25416956 2014 A proteome-scale map of the human interactome network.
25333931 2014 MicroRNA-147b regulates vascular endothelial barrier function by targeting ADAM15 expression.
25208722 2015 The ADAM15 ectodomain is shed from secretory exosomes.
23918525 2013 ADAM15 adds to apoptosis resistance of synovial fibroblasts by modulating focal adhesion kinase signaling.
23910172 2013 Molecular implication of ADAM-15 and -17 in intrauterine adhesions.
23688428 2013 Recombinant disintegrin domain of ADAM15 inhibits the proliferation and migration of Bel-7402 cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
More...