Property Summary

NCBI Gene PubMed Count 74
Grant Count 27
R01 Count 19
Funding $1,563,656.72
PubMed Score 113.56
PubTator Score 108.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (57)

PMID Text
26592768 Activation of ERalpha but not ERbeta increases ADAM9 expression in cultured human neuronal cells.
26553452 ADAM9 enhances CDCP1 protein expression by suppressing miR-218 for lung tumor metastasis
26507842 ADAM9 and ROS1 are direct downstream targets of miR-33a
26261534 miR-126 may act as a tumor suppressor via inhibition of cell invasion by downregulating ADAM9 in breast cancer development.
26179263 results suggested that miR-203 played tumor suppressive roles by downregulating ADAM9 and HULC and indicated its potential application in cancer treatment
25778452 ADAM9 silencing inhibits the tumor growth of non-small lung cancer in vitro and in vivo.
25646025 This study has identified tenascin-C as a promoter of the invasiveness of brain tumor-initiating cells through a mechanism involving ADAM-9 proteolysis via the c-Jun NH2-terminal kinase pathway.
25546566 Whole exome sequencing was performed, which identified a novel, homozygous mutation in ADAM9, c.967delT; p.Ser323Glnfs*33.
25344581 ADAM9 plays an important role in gastric cancer proliferation and invasion, and that while expressed at high levels in some cancer cells that are responsive to functional inhibition and antitumor activity of a catalytic site-directed antibody.
25213697 our data indicated that miR-126 inhibits cell growth, invasion, and migration of OS cells by downregulating ADAM-9.
More...

AA Sequence

MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVI      1 - 70
QAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLL     71 - 140
HLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ    141 - 210
TRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDV    211 - 280
LGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELG    281 - 350
HNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK    351 - 420
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSS    421 - 490
QFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEY    491 - 560
KKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICR    561 - 630
NFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLL    631 - 700
VFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYA    701 - 770
NRFAVPTYAAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT                         771 - 819
//

Text Mined References (78)

PMID Year Title
26592768 2016 Estrogen induced the expression of ADAM9 through estrogen receptor ? but not estrogen receptor ? in cultured human neuronal cells.
26553452 2015 ADAM9 enhances CDCP1 protein expression by suppressing miR-218 for lung tumor metastasis.
26507842 2015 MiR-33a suppresses breast cancer cell proliferation and metastasis by targeting ADAM9 and ROS1.
26261534 2015 MiR-126 regulated breast cancer cell invasion by targeting ADAM9.
26179263 2016 miR-203 suppresses the proliferation and metastasis of hepatocellular carcinoma by targeting oncogene ADAM9 and oncogenic long non-coding RNA HULC.
25778452 2015 RNAi-mediated A disintegrin and metalloproteinase 9 gene silencing inhibits the tumor growth of non-small lung cancer in vitro and in vivo.
25646025 2015 ADAM-9 is a novel mediator of tenascin-C-stimulated invasiveness of brain tumor-initiating cells.
25546566 2015 Exome sequencing reveals ADAM9 mutations in a child with cone-rod dystrophy.
25344581 2014 The effect of disintegrin-metalloproteinase ADAM9 in gastric cancer progression.
25213697 2014 miR-126 inhibits cell growth, invasion, and migration of osteosarcoma cells by downregulating ADAM-9.
More...