Property Summary

NCBI Gene PubMed Count 74
PubMed Score 113.56
PubTator Score 108.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ependymoma 2514 9.47832531627014E-8
pancreatic cancer 2300 3.73305838258141E-6
acute quadriplegic myopathy 1157 1.36568578816706E-5
non-small cell lung cancer 2798 3.44405936716911E-5
pilocytic astrocytoma 3086 1.67612598158274E-4
osteosarcoma 7933 2.56408054799824E-4
atypical teratoid / rhabdoid tumor 4369 2.97176437675782E-4
ovarian cancer 8492 3.95819752375345E-4
glioblastoma 5572 4.94697755038481E-4
psoriasis 6685 9.19415073957831E-4
active ulcerative colitis 477 9.32513185070171E-4
pediatric high grade glioma 2712 0.00134472341701642
active Crohn's disease 918 0.00143604773365635
primary pancreatic ductal adenocarcinoma 1271 0.002041604062146
dermatomyositis 967 0.00218126900127724
medulloblastoma, large-cell 6234 0.00242324025737394
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00286976023796015
group 4 medulloblastoma 1875 0.00623430161037606
progressive supranuclear palsy 674 0.00641887296099488
lung cancer 4473 0.00866946877252761
invasive ductal carcinoma 2950 0.00928899184912151
Rheumatoid Arthritis 1171 0.00979202922401113
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0322488650836475
gastric cancer 436 0.0369035352553562
astrocytoma 1493 0.038807807776624
aldosterone-producing adenoma 664 0.0498187448242833
Disease Target Count Z-score Confidence
Cancer 2346 3.687 1.8
Alzheimer's disease 644 3.071 1.5

Expression

Synonym

Accession Q13443 B7ZLN7 Q10718 Q8NFM6 ADAM 9
Symbols MCMP
MDC9
CORD9
Mltng

Gene

PDB

1M1V  

  Ortholog (10)

 CSPA Cell Line (3)

Gene RIF (57)

PMID Text
26592768 Activation of ERalpha but not ERbeta increases ADAM9 expression in cultured human neuronal cells.
26553452 ADAM9 enhances CDCP1 protein expression by suppressing miR-218 for lung tumor metastasis
26507842 ADAM9 and ROS1 are direct downstream targets of miR-33a
26261534 miR-126 may act as a tumor suppressor via inhibition of cell invasion by downregulating ADAM9 in breast cancer development.
26179263 results suggested that miR-203 played tumor suppressive roles by downregulating ADAM9 and HULC and indicated its potential application in cancer treatment
25778452 ADAM9 silencing inhibits the tumor growth of non-small lung cancer in vitro and in vivo.
25646025 This study has identified tenascin-C as a promoter of the invasiveness of brain tumor-initiating cells through a mechanism involving ADAM-9 proteolysis via the c-Jun NH2-terminal kinase pathway.
25546566 Whole exome sequencing was performed, which identified a novel, homozygous mutation in ADAM9, c.967delT; p.Ser323Glnfs*33.
25344581 ADAM9 plays an important role in gastric cancer proliferation and invasion, and that while expressed at high levels in some cancer cells that are responsive to functional inhibition and antitumor activity of a catalytic site-directed antibody.
25213697 our data indicated that miR-126 inhibits cell growth, invasion, and migration of OS cells by downregulating ADAM-9.
More...

AA Sequence

MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVI      1 - 70
QAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLL     71 - 140
HLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ    141 - 210
TRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDV    211 - 280
LGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELG    281 - 350
HNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK    351 - 420
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSS    421 - 490
QFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEY    491 - 560
KKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICR    561 - 630
NFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLL    631 - 700
VFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYA    701 - 770
NRFAVPTYAAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT                         771 - 819
//

Text Mined References (78)

PMID Year Title
26592768 2016 Estrogen induced the expression of ADAM9 through estrogen receptor ? but not estrogen receptor ? in cultured human neuronal cells.
26553452 2015 ADAM9 enhances CDCP1 protein expression by suppressing miR-218 for lung tumor metastasis.
26507842 2015 MiR-33a suppresses breast cancer cell proliferation and metastasis by targeting ADAM9 and ROS1.
26261534 2015 MiR-126 regulated breast cancer cell invasion by targeting ADAM9.
26179263 2016 miR-203 suppresses the proliferation and metastasis of hepatocellular carcinoma by targeting oncogene ADAM9 and oncogenic long non-coding RNA HULC.
25778452 2015 RNAi-mediated A disintegrin and metalloproteinase 9 gene silencing inhibits the tumor growth of non-small lung cancer in vitro and in vivo.
25646025 2015 ADAM-9 is a novel mediator of tenascin-C-stimulated invasiveness of brain tumor-initiating cells.
25546566 2015 Exome sequencing reveals ADAM9 mutations in a child with cone-rod dystrophy.
25344581 2014 The effect of disintegrin-metalloproteinase ADAM9 in gastric cancer progression.
25213697 2014 miR-126 inhibits cell growth, invasion, and migration of osteosarcoma cells by downregulating ADAM-9.
More...