Property Summary

Ligand Count 23
NCBI Gene PubMed Count 87
PubMed Score 122.35
PubTator Score 108.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
CONE-ROD DYSTROPHY 9 1 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.822 1.9
Alzheimer's disease 658 3.001 1.5
Disease Target Count
cone-rod dystrophy 59

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.373 1.4e-03
active ulcerative colitis 1.011 2.0e-02
acute quadriplegic myopathy 1.281 1.4e-05
aldosterone-producing adenoma -1.319 5.0e-02
astrocytoma 1.500 3.9e-02
Astrocytoma, Pilocytic 1.900 1.9e-04
atypical teratoid / rhabdoid tumor 2.000 3.0e-04
dermatomyositis 1.600 2.2e-03
ependymoma 1.800 9.5e-08
gastric cancer -1.100 3.7e-02
glioblastoma 1.400 1.1e-03
group 4 medulloblastoma -1.200 6.2e-03
intraductal papillary-mucinous adenoma (... 1.800 3.2e-02
intraductal papillary-mucinous neoplasm ... 1.200 2.9e-03
invasive ductal carcinoma 1.300 9.3e-03
lung cancer -1.200 8.7e-03
medulloblastoma, large-cell -1.200 2.4e-03
non-small cell lung cancer 1.094 3.4e-05
osteosarcoma 3.436 2.6e-04
ovarian cancer -1.900 4.0e-04
pancreatic cancer 1.800 3.7e-06
pediatric high grade glioma 1.800 1.3e-03
primary pancreatic ductal adenocarcinoma 1.594 2.0e-03
progressive supranuclear palsy -1.300 6.4e-03
psoriasis 1.100 9.2e-04
Rheumatoid arthritis 1.300 9.8e-03

 CSPA Cell Line (3)

Gene RIF (69)

AA Sequence

MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVI      1 - 70
QAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLL     71 - 140
HLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ    141 - 210
TRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDV    211 - 280
LGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELG    281 - 350
HNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK    351 - 420
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSS    421 - 490
QFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEY    491 - 560
KKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICR    561 - 630
NFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLL    631 - 700
VFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYA    701 - 770
NRFAVPTYAAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT                         771 - 819
//

Text Mined References (90)

PMID Year Title