Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.23
PubTator Score 70.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 2.61487177599958E-7
psoriasis 6685 1.39241092870305E-4
posterior fossa group B ependymoma 1530 1.6414335481886E-4
dermatomyositis 967 3.25250027460823E-4
group 3 medulloblastoma 2254 0.0024448423121446
lung cancer 4473 0.00339762495717142

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -2.700 0.000
osteosarcoma -2.745 0.000
lung cancer -1.500 0.003
group 3 medulloblastoma 1.900 0.002
posterior fossa group B ependymoma 1.100 0.000
dermatomyositis -2.000 0.000

Synonym

Accession Q13442 D6W5S5 Q92906
Symbols PAP
PAP1
HASPP28

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
25631074 Cellular biotinylated 28 kDa heat- and acid-stable phosphoprotein protein is incorporated into HIV-1 Gag virus-like particles

AA Sequence

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY      1 - 70
QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL     71 - 140
ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK                                 141 - 181
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...