Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.22
PubTator Score 70.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.1e-05
posterior fossa group B ependymoma 416 1.6e-04
dermatomyositis 966 3.3e-04
psoriasis 6694 3.3e-04
group 3 medulloblastoma 4104 2.4e-03
lung cancer 4740 8.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis -2.000 3.3e-04
group 3 medulloblastoma 1.900 2.4e-03
lung cancer -1.200 8.4e-03
osteosarcoma 1.425 4.1e-05
posterior fossa group B ependymoma 1.100 1.6e-04
psoriasis -1.700 3.3e-04

Synonym

Accession Q13442 D6W5S5 Q92906
Symbols PAP
PAP1
HASPP28

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY      1 - 70
QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL     71 - 140
ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK                                 141 - 181
//

Text Mined References (26)

PMID Year Title