Property Summary

NCBI Gene PubMed Count 41
PubMed Score 57.07
PubTator Score 39.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.300 1.6e-03
astrocytoma 1.400 8.2e-04
Astrocytoma, Pilocytic 1.500 1.7e-06
atypical teratoid / rhabdoid tumor 1.400 1.1e-07
ependymoma 1.100 2.4e-07
glioblastoma 1.300 3.7e-04
medulloblastoma 1.200 2.7e-07
medulloblastoma, large-cell 1.400 8.3e-04
Multiple myeloma 1.108 9.8e-04
ovarian cancer 1.100 7.4e-05
pancreatic ductal adenocarcinoma liver m... -1.217 1.2e-02
primitive neuroectodermal tumor 1.100 5.1e-05
psoriasis -1.300 2.0e-04
Rheumatoid arthritis -1.100 1.7e-02

 IMPC Phenotype (1)

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (21)

AA Sequence

MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDVVIVSSKYKQR      1 - 70
YECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKG     71 - 140
EVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRV    141 - 210
DEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLG    211 - 280
PQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDF    281 - 350
QNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDED    351 - 420
EDEDEDEDERQLLGEFEKELEGILLPSDRDRLRSEVKAGMERELENIIQETEKELDPDGLKKESERDRAM    421 - 490
LALTSTLNKLIKRLEEKQSPELVKKHKKKRVVPKKPPPSPQPTEEDPEHRVRVRVTKLRLGGPNQDLTVL    491 - 560
EMKRENPQLKQIEGLVKELLEREGLTAAGKIEIKIVRPWAEGTEEGARWLTDEDTRNLKEIFFNILVPGA    561 - 630
EEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF                                     631 - 667
//

Text Mined References (46)

PMID Year Title