Property Summary

NCBI Gene PubMed Count 39
PubMed Score 57.39
PubTator Score 39.03

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Rheumatoid Arthritis 1171
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.09786170424903E-7
ependymoma 2514 2.42411496085808E-7
medulloblastoma 1524 2.73699560168484E-7
glioblastoma 5572 6.78016742778727E-7
pilocytic astrocytoma 3086 1.35816014981831E-6
primitive neuroectodermal tumor 3031 5.08766801356704E-5
ovarian cancer 8492 7.36715595914609E-5
psoriasis 6685 2.02535371919629E-4
adult high grade glioma 2148 5.54514578157329E-4
medulloblastoma, large-cell 6234 8.26916753395957E-4
Multiple myeloma 1328 9.82277854540857E-4
astrocytoma 1493 0.00106481782857907
pancreatic ductal adenocarcinoma liver metastasis 1795 0.011945233233507
Disease Target Count Z-score Confidence
Hypersensitivity reaction type II disease 235 0.0 1.0
Disease Target Count Z-score Confidence
Familial encephalopathy with neuroserpin inclusion bodies 8 3.129 1.6


  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.017
Multiple myeloma 1.108 0.001
psoriasis -1.300 0.000
ependymoma 1.100 0.000
glioblastoma 1.900 0.000
astrocytoma 1.600 0.001
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.400 0.001
primitive neuroectodermal tumor 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.217 0.012
adult high grade glioma 2.000 0.001
pilocytic astrocytoma 1.500 0.000
ovarian cancer 1.100 0.000





  Ortholog (9)

 MGI Term (1)

 GWAS Trait (1)

Gene RIF (19)

25999789 OS-9 up-regulates occludin and claudin-1 by activating the MAP kinase (MAPK) pathway, and thus protects the epithelial barrier function of Caco-2 monolayer under hypoxia condition.
25314054 long non-coding RNA ENST00000480739 suppresses tumour cell invasion by regulating OS-9 and HIF-1alpha in pancreatic ductal adenocarcinoma.
24910992 EDEM2 and OS-9 are required for ER-associated degradation of non-glycosylated sonic hedgehog
24899641 Unique regions mediate the interaction between OS-9 and GRP94.
24795221 It delivers mutant neuroserpin to ERAD by recognition of glycan side chains and provide the first in vivo proof of involvement of ERAD in degradation of mutant neuroserpin.
23097496 Data indicate that the interaction of OS-9 and XTP3-B with CD147(CG) was inhibited by mutations to conserved residues in their lectin domains.
22190034 HIV-1 gp160 is identified to have a physical interaction with osteosarcoma amplified 9, endoplasmic reticulum lectin (OS9) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21559462 OS-9 plays no direct functional role in HIF degradation since physical interaction of OS-9 with oxygen sensing HIF prolyl hydroxylases cannot occur in vivo due to their different subcellular localization
21404621 It regulates endoplasmic reticulum-associated degradation. (review)
21172656 The OS-9 specifically recognizes Manalpha1,6Manalpha1,6Man residues on the processed C-arm through the continuous double tryptophan (WW) motif.

AA Sequence

EEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF                                     631 - 667

Text Mined References (44)

PMID Year Title
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26721884 2016 OS9 Protein Interacts with Na-K-2Cl Co-transporter (NKCC2) and Targets Its Immature Form for the Endoplasmic Reticulum-associated Degradation Pathway.
25999789 2015 A Novel Role of OS-9 in the Maintenance of Intestinal Barrier Function from Hypoxia-induced Injury via p38-dependent Pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25314054 2014 A novel long non-coding RNA ENST00000480739 suppresses tumour cell invasion by regulating OS-9 and HIF-1? in pancreatic ductal adenocarcinoma.
24910992 2014 EDEM2 and OS-9 are required for ER-associated degradation of non-glycosylated sonic hedgehog.
24899641 2014 OS-9 facilitates turnover of nonnative GRP94 marked by hyperglycosylation.
24795221 2014 Lectin OS-9 delivers mutant neuroserpin to endoplasmic reticulum associated degradation in familial encephalopathy with neuroserpin inclusion bodies.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.