Property Summary

NCBI Gene PubMed Count 33
PubMed Score 50.00
PubTator Score 50.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (42)

Disease log2 FC p
Breast cancer 2.900 3.6e-02
active Crohn's disease 1.089 9.6e-03
acute myeloid leukemia 1.800 2.3e-02
acute quadriplegic myopathy 1.385 5.9e-06
adrenocortical carcinoma 1.198 1.1e-02
aldosterone-producing adenoma -1.371 4.8e-02
Alzheimer's disease -1.300 4.9e-02
astrocytic glioma 1.400 4.8e-03
Astrocytoma, Pilocytic 1.400 1.1e-03
atypical teratoid / rhabdoid tumor 2.000 1.1e-05
autosomal dominant Emery-Dreifuss muscul... 1.086 5.8e-03
breast carcinoma 1.400 2.4e-03
dermatomyositis 2.300 2.2e-04
Down syndrome 1.400 3.0e-03
ductal carcinoma in situ 1.100 4.6e-02
ependymoma 1.400 2.0e-02
fibroadenoma 1.400 2.6e-03
glioblastoma 1.300 8.4e-04
group 3 medulloblastoma 1.700 1.9e-02
interstitial cystitis -1.200 7.4e-03
invasive ductal carcinoma 2.200 2.9e-02
juvenile dermatomyositis 1.142 1.3e-09
lung adenocarcinoma 1.490 2.5e-05
lung cancer 1.600 5.6e-03
lung carcinoma 1.400 3.8e-28
medulloblastoma, large-cell 2.100 6.0e-06
Multiple myeloma 2.137 2.2e-03
nasopharyngeal carcinoma 1.400 3.2e-04
non-small cell lung cancer 1.578 4.4e-15
oligodendroglioma 1.500 1.1e-02
osteosarcoma 3.028 7.9e-06
ovarian cancer -1.900 7.7e-04
pancreatic cancer -1.300 2.2e-03
pancreatic carcinoma -1.300 2.2e-03
pediatric high grade glioma 1.300 6.7e-03
Pick disease -1.700 1.2e-05
primitive neuroectodermal tumor 1.900 6.2e-06
progressive supranuclear palsy -1.500 1.1e-02
psoriasis 1.400 1.8e-06
subependymal giant cell astrocytoma -1.107 3.4e-02
ulcerative colitis 1.600 2.1e-06
Waldenstrons macroglobulinemia 1.140 3.2e-02

Gene RIF (28)

AA Sequence

MARKLSVILILTFALSVTNPLHELKAAAFPQTTEKISPNWESGINVDLAISTRQYHLQQLFYRYGENNSL      1 - 70
SVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHERHSDHEHHSEHEHHSDHDHHSHHNHAASGKN     71 - 140
KRKALCPDHDSDSSGKDPRNSQGKGAHRPEHASGRRNVKDSVSASEVTSTVYNTVSEGTHFLETIETPRP    141 - 210
GKLFPKDVSSSTPPSVTSKSRVSRLAGRKTNESVSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQV    211 - 280
PLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN    281 - 350
RVFFKFLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDS    351 - 420
TWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRT    421 - 490
EGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHD    491 - 560
YHHILHHHHHQNHHPHSHSQRYSREELKDAGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSV    561 - 630
AVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYV    631 - 700
ALVDMVPEMLHNDASDHGCSRWGYFFLQNAGMLLGFGIMLLISIFEHKIVFRINF                   701 - 755
//

Text Mined References (39)

PMID Year Title