Property Summary

NCBI Gene PubMed Count 30
PubMed Score 47.80
PubTator Score 50.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 3.80986818403373E-28
non-small cell lung cancer 2798 4.36299636819048E-15
juvenile dermatomyositis 1189 1.28161713640282E-9
atypical teratoid / rhabdoid tumor 4369 8.91732054831742E-8
osteosarcoma 7933 1.0856094054679E-7
medulloblastoma, large-cell 6234 2.44262268355142E-7
ulcerative colitis 2087 2.09996889262917E-6
glioblastoma 5572 4.84740656465715E-6
psoriasis 6685 5.12701194340955E-6
acute quadriplegic myopathy 1157 5.86760311780102E-6
Pick disease 1893 1.21432318825756E-5
primitive neuroectodermal tumor 3031 1.22024072258441E-5
interstitial cystitis 2299 1.80326539231006E-5
lung adenocarcinoma 2714 2.54040330140027E-5
pilocytic astrocytoma 3086 2.59098328736466E-5
group 4 medulloblastoma 1875 3.91922028142971E-5
breast carcinoma 1614 1.3859758903649E-4
dermatomyositis 967 2.22512220628084E-4
nasopharyngeal carcinoma 1056 3.15500229306995E-4
pediatric high grade glioma 2712 4.07590045497378E-4
ovarian cancer 8492 7.71449173980531E-4
Multiple myeloma 1328 0.00222200937942505
pancreatic cancer 2300 0.00224652513502322
pancreatic carcinoma 567 0.00224652513502322
fibroadenoma 557 0.00255574050942552
Down syndrome 548 0.0030426897783013
oligodendroglioma 2849 0.00326900269956658
astrocytic glioma 2241 0.00478743286891372
lung cancer 4473 0.00564701979714214
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00578490427918558
active Crohn's disease 918 0.0095886549080426
progressive supranuclear palsy 674 0.0106366779846408
adrenocortical carcinoma 1427 0.0113102400345757
ependymoma 2514 0.020080268950675
acute myeloid leukemia 785 0.022854289140708
invasive ductal carcinoma 2950 0.0291437330711792
Waldenstrons macroglobulinemia 765 0.0321837029333428
subependymal giant cell astrocytoma 2287 0.0344613765230802
ductal carcinoma in situ 1745 0.0459965292097523
aldosterone-producing adenoma 664 0.0477018100827648
Alzheimer's disease 644 0.0485926753494386
Disease Target Count Z-score Confidence
Breast cancer 3099 3.38 1.7

Expression

  Differential Expression (42)

Synonym

Accession Q13433 B4DR49 B4E224 Q8IXR3 Q96HP5
Symbols ZIP6
LIV-1

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (24)

PMID Text
26444413 SLC39A6 may have a tumor promoting role in esophageal carcinoma
25969539 Knock-down of ZIP6 but not ZIP7 in MIN6 beta cells impaired the protective effects of GLP-1 on fatty acid-induced cell apoptosis, possibly via reduced activation of the p-ERK pathway
25420545 drug resistance of ovarian cancer cells to trichostatin A may be related to expression of the LIV1 gene
24587242 Zinc and its transporters, ZIP6 and ZIP10, are required for the breast cancer cells motility stimulated with high glucose level, such as in diabetes.
23919497 a causative role for ZIP6 in cell motility and migration
23644492 SLC39A6 has an important role in the prognosis of esophageal squamous-cell carcinoma and may be a potential therapeutic target.
23437163 Down-regulated LIV-1 cells showed significant inhibition of proliferation in vitro and reduction of tumor growth in vivo. Furthermore, E-cadherin expression increased in LIV-1 siRNA expressing Hep-G2.
22852056 Some studies correlate LIV-1 expression with a more aggressive cancer phenotype and increased likelihood for metastasis to lymph nodes. In contrast, other evidence suggests this transporter is associated with a more favorable prognosis. [review]
22349685 The results of this study showed evidence for a positive correlation between LIV1 and ZnT6 insuperior temporal, occipital, and frontal gyri in patient with alzheimer disease.
22110740 LIV-1 is involved in prostate cancer progression as an intracellular target of growth factor receptor signaling which promoted EMT and cancer metastasis
More...

AA Sequence

MARKLSVILILTFALSVTNPLHELKAAAFPQTTEKISPNWESGINVDLAISTRQYHLQQLFYRYGENNSL      1 - 70
SVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHERHSDHEHHSEHEHHSDHDHHSHHNHAASGKN     71 - 140
KRKALCPDHDSDSSGKDPRNSQGKGAHRPEHASGRRNVKDSVSASEVTSTVYNTVSEGTHFLETIETPRP    141 - 210
GKLFPKDVSSSTPPSVTSKSRVSRLAGRKTNESVSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQV    211 - 280
PLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN    281 - 350
RVFFKFLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDS    351 - 420
TWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRT    421 - 490
EGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHD    491 - 560
YHHILHHHHHQNHHPHSHSQRYSREELKDAGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSV    561 - 630
AVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYV    631 - 700
ALVDMVPEMLHNDASDHGCSRWGYFFLQNAGMLLGFGIMLLISIFEHKIVFRINF                   701 - 755
//

Text Mined References (36)

PMID Year Title
26444413 2015 SLC39A6: a potential target for diagnosis and therapy of esophageal carcinoma.
25969539 2015 Characterization of Zinc Influx Transporters (ZIPs) in Pancreatic ? Cells: ROLES IN REGULATING CYTOSOLIC ZINC HOMEOSTASIS AND INSULIN SECRETION.
25420545 2015 Effect of LIV1 on the sensitivity of ovarian cancer cells to trichostatin A.
24587242 2014 High glucose level promotes migration behavior of breast cancer cells through zinc and its transporters.
23919497 2013 A mechanism for epithelial-mesenchymal transition and anoikis resistance in breast cancer triggered by zinc channel ZIP6 and STAT3 (signal transducer and activator of transcription 3).
23644492 2013 Genome-wide association study identifies common variants in SLC39A6 associated with length of survival in esophageal squamous-cell carcinoma.
23437163 2013 Negative correlation of LIV-1 and E-cadherin expression in hepatocellular carcinoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22852056 2012 Zinc and cancer: implications for LIV-1 in breast cancer.
22349685 2012 Zinc transporter mRNA levels in Alzheimer's disease postmortem brain.
More...