Property Summary

NCBI Gene PubMed Count 34
PubMed Score 109.46
PubTator Score 16.59

Knowledge Summary


No data available


  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.800 2.9e-05
psoriasis 1.100 2.7e-03

 GO Function (1)

 OMIM Phenotype (1)

Gene RIF (18)

AA Sequence

PYETQSDSFYFVDDRLVMHNKADYSYSGTP                                            211 - 240

Text Mined References (38)

PMID Year Title