Property Summary

NCBI Gene PubMed Count 30
Grant Count 30
R01 Count 21
Funding $3,127,823.36
PubMed Score 96.78
PubTator Score 16.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.003
group 3 medulloblastoma 1.800 0.000

 GO Function (1)

Gene RIF (15)

PMID Text
23535298 UNC119a bridges the transmission of Fyn signals to Rab11, leading to the completion of cytokinesis.
23227982 Expression of SH3/SH2 ligand-uncoordinated 119 (UNC119) completely reverses the HIV-1 Nef-mediated inhibition of immunological synapse recruitment of LCK
23072788 The profile of UNC119a subcellular distribution remained largely unchanged under all tested conditions of illumination, and correlated with the profile of Galpha(t1) following its light-dependent translocation.
22960633 Crystal structures of Arl3 in complex with UNC119a reveal the molecular basis of specificity. The N-terminal amphipathic helix of Arl3.GppNHp is not displaced by the interswitch toggle but remains bound on the surface of the protein
22729960 The discovery of the UNC119 defect provides a molecular mechanism for a subset of patients with this previously unexplained disease. Here we review our recent findings on the UNC119 mutation in ICL.
22123847 Expression of SH3/SH2 ligand-uncoordinated 119 (UNC119) completely reverses the HIV-1 Nef-mediated inhibition of immunological synapse recruitment of LCK
21712387 Interaction of transducin with uncoordinated 119 protein (UNC119): implications for the model of transducin trafficking in rod photoreceptors.
21642972 This study demonistrated that UNC119 is a Galpha subunit cofactor essential for G protein trafficking in sensory cilia.
20801516 Observational study of genetic testing. (HuGE Navigator)
20220094 Heightened expression of Unc119 promotes T helper type (Th)2 cells, inhibits Th1 cell differentiation, and contributes to the pathogenesis of asthma in humans.
More...

AA Sequence

MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQR      1 - 70
ITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRL     71 - 140
RQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRH    141 - 210
PYETQSDSFYFVDDRLVMHNKADYSYSGTP                                            211 - 240
//

Text Mined References (34)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
23535298 2013 UNC119a bridges the transmission of Fyn signals to Rab11, leading to the completion of cytokinesis.
23072788 2013 Expression and subcellular distribution of UNC119a, a protein partner of transducin ? subunit in rod photoreceptors.
22960633 2012 Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
22729960 2012 Consequences of a mutation in the UNC119 gene for T cell function in idiopathic CD4 lymphopenia.
22184408 2012 A mutation in the human Uncoordinated 119 gene impairs TCR signaling and is associated with CD4 lymphopenia.
22085962 2011 An ARL3-UNC119-RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium.
21712387 2011 Interaction of transducin with uncoordinated 119 protein (UNC119): implications for the model of transducin trafficking in rod photoreceptors.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
More...