Property Summary

NCBI Gene PubMed Count 18
Grant Count 1,145
R01 Count 650
Funding $149,052,030.3
PubMed Score 4172.39
PubTator Score 272.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q13427 D3DPC5 D3DPC6 O00706 Q53R40 Q53SN4 Q96DG9 PPIase G
Symbols CYP
SRCyp
SCAF10
CARS-Cyp

Gene

PANTHER Protein Class (1)

PDB

2GW2   2WFI   2WFJ  

Gene RIF (4)

PMID Text
23166591 Expression of HIV-1 Tat downregulates the abundance of peptidylprolyl isomerase G (PPIG, cyclophilin G) in the nucleoli of Jurkat T-cells
19058789 Observational study of gene-disease association. (HuGE Navigator)
15358154 Results show that SR-cyclophilin interacts and colocalizes with nuclear pinin, a SR-related protein involved in pre-mRNA splicing.
15016823 human nuclear SRcyp is a cell cycle-regulated cyclophilin

AA Sequence

MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVK      1 - 70
DFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVV     71 - 140
FGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPKSKVKKEEKKRHKSSSSSSSSSSDSDSSSDS    141 - 210
QSSSDSSDSESATEEKSKKRKKKHRKNSRKHKKEKKKRKKSKKSASSESEAENLEAQPQSTVRPEEIPPI    211 - 280
PENRFLMRKSPPKADEKERKNRERERERECNPPNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSR    281 - 350
DRFRRSETPPHWRQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKN    351 - 420
EKEKKVKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEKSKSKERDSKHNRNEEKRMRSRSK    421 - 490
GRDHENVKEKEKQSDSKGKDQERSRSKEKSKQLESKSNEHDHSKSKEKDRRAQSRSRECDITKGKHSYNS    491 - 560
RTRERSRSRDRSRRVRSRTHDRDRSRSKEYHRYREQEYRRRGRSRSRERRTPPGRSRSKDRRRRRRDSRS    561 - 630
SEREESQSRNKDKYRNQESKSSHRKENSESEKRMYSKSRDHNSSNNSREKKADRDQSPFSKIKQSSQDNE    631 - 700
LKSSMLKNKEDEKIRSSVEKENQKSKGQENDHVHEKNKKFDHESSPGTDEDKSG                    701 - 754
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...