Property Summary

Ligand Count 3
NCBI Gene PubMed Count 18
PubMed Score 4420.99
PubTator Score 272.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.2e-02
Becker muscular dystrophy -1.138 4.2e-03
dermatomyositis 1.300 8.6e-04
group 4 medulloblastoma -1.100 2.7e-02
intraductal papillary-mucinous adenoma (... 1.500 2.6e-04
intraductal papillary-mucinous carcinoma... 1.200 3.5e-04
juvenile dermatomyositis 1.181 2.0e-07
medulloblastoma, large-cell -1.400 6.2e-04
ovarian cancer 1.300 1.5e-08
Pick disease 1.500 2.2e-05
psoriasis -1.700 3.8e-05
Rheumatoid arthritis 1.300 4.3e-03

Gene RIF (4)

AA Sequence

MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVK      1 - 70
DFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVV     71 - 140
FGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPKSKVKKEEKKRHKSSSSSSSSSSDSDSSSDS    141 - 210
QSSSDSSDSESATEEKSKKRKKKHRKNSRKHKKEKKKRKKSKKSASSESEAENLEAQPQSTVRPEEIPPI    211 - 280
PENRFLMRKSPPKADEKERKNRERERERECNPPNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSR    281 - 350
DRFRRSETPPHWRQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKN    351 - 420
EKEKKVKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEKSKSKERDSKHNRNEEKRMRSRSK    421 - 490
GRDHENVKEKEKQSDSKGKDQERSRSKEKSKQLESKSNEHDHSKSKEKDRRAQSRSRECDITKGKHSYNS    491 - 560
RTRERSRSRDRSRRVRSRTHDRDRSRSKEYHRYREQEYRRRGRSRSRERRTPPGRSRSKDRRRRRRDSRS    561 - 630
SEREESQSRNKDKYRNQESKSSHRKENSESEKRMYSKSRDHNSSNNSREKKADRDQSPFSKIKQSSQDNE    631 - 700
LKSSMLKNKEDEKIRSSVEKENQKSKGQENDHVHEKNKKFDHESSPGTDEDKSG                    701 - 754
//

Text Mined References (27)

PMID Year Title