Property Summary

NCBI Gene PubMed Count 191
Grant Count 148
R01 Count 107
Funding $14,964,617.34
PubMed Score 222.74
PubTator Score 213.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13426 A8K3X4 Q9BS72 Q9UP94
Symbols SSMED

Gene

PDB

1FU1   1IK9   3II6   3MUD   3Q4F   3RWR   3SR2   3W03   4XA4   5CHX   5CJ0   5CJ4   5E50  

 GO Function (1)

Gene RIF (151)

PMID Text
27437582 using dual- and quadruple-trap optical tweezers combined with fluorescence microscopy, we show how human XRCC4, XLF and XRCC4-XLF complexes interact with DNA in real time
26990988 The ends are then closely aligned, which requires XLF, a non-catalytic function of XRCC4-LIG4, and DNA-PK activity
26774286 FBXW7 facilitates nonhomologous end-joining via K63-linked polyubiquitylation of XRCC4 in tumor cells.
26484731 Association between insertion/deletion polymorphism in intron 3 of XRCC4 and susceptibility to type I bipolar disorder
26345895 Our results suggest that the XRCC4 rs2075685 polymorphism could influence the susceptibility to pancreatic cancer in a Chinese population.
26201248 Our data showed that Cd altered the phosphorylation of DNA-PKcs, and reduced the expression of both XRCC4 and Ligase IV in irradiated cells.
26166223 For XRCC4 (rs1805377) polymorphism, no difference was found in distribution between the ESCC and control groups.
26112447 Genetic susceptibility to schizophrenia was found in patients with genetic polymorphisms in intron 3 of the XRCC4 gene.
26088159 The XRCC4 -1394T/G polymorphism is associated with susceptibility to endometriosis in an Iranian population.
26045837 our results suggest that XRCC4 rs2075685 polymorphism plays an important role in the risk of pancreatic cancer in a Chinese population
More...

AA Sequence

MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL      1 - 70
RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK     71 - 140
NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK    141 - 210
QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL    211 - 280
GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI                  281 - 336
//

Text Mined References (201)

PMID Year Title
27437582 2016 Sliding sleeves of XRCC4-XLF bridge DNA and connect fragments of broken DNA.
26990988 2016 Two-Stage Synapsis of DNA Ends during Non-homologous End Joining.
26774286 2016 FBXW7 Facilitates Nonhomologous End-Joining via K63-Linked Polyubiquitylation of XRCC4.
26484731 2016 Association between insertion/deletion polymorphism in intron 3 of XRCC4 and susceptibility to type I bipolar disorder.
26345895 2015 Association between single nucleotide polymorphisms of X-ray repair cross-complementing protein 4 gene and development of pancreatic cancer.
26255102 2015 XRCC4 deficiency in human subjects causes a marked neurological phenotype but no overt immunodeficiency.
26201248 2015 Cadmium delays non-homologous end joining (NHEJ) repair via inhibition of DNA-PKcs phosphorylation and downregulation of XRCC4 and Ligase IV.
26166223 Association of genetic polymorphisms in PRKDC and XRCC4 with risk of ESCC in a high-incidence region of North China.
26112447 2015 Susceptibility to schizophrenia and insertion/deletion polymorphism in intron 3 of the XRCC4 gene.
26088159 2015 DNA repair gene XRCC1 and XRCC4 variations and risk of endometriosis: an association study.
More...