Property Summary

NCBI Gene PubMed Count 30
PubMed Score 14.68
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 5.73111686951432E-10
ovarian cancer 8492 7.14889362619917E-10
gastric cancer 436 1.31399570359966E-4
invasive ductal carcinoma 2950 1.32908876496406E-4
ductal carcinoma in situ 1745 5.73394179190926E-4
pancreatic cancer 2300 0.00198606875080999
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00272188147514312
primary pancreatic ductal adenocarcinoma 1271 0.00525498930797529
medulloblastoma, large-cell 6234 0.00843205577976999
astrocytic glioma 2241 0.0101616600502348
mucosa-associated lymphoid tissue lymphoma 480 0.0175367581982256
aldosterone-producing adenoma 664 0.0204268626695346
Polycystic Ovary Syndrome 335 0.0253343009600969
oligodendroglioma 2849 0.0310775803262954
ependymoma 2514 0.0320239752237489

Expression

Synonym

Accession Q13425 Q9BY09
Symbols SNT3
SNTL
SNT2B2
EST25263
D16S2531E

Gene

PDB

2VRF  

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
22735534 conformational plasticity of the native ensemble of this PDZ domain and the regulation of insulin secretion
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntrophin
12899872 patients with deficiency of beta2-syntrophin and alpha-dystrobrevin presented with severe congenital weakness and died in the first year of life

AA Sequence

MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAF      1 - 70
NGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPI     71 - 140
LISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV    141 - 210
SDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLIL    211 - 280
RCKDTATAHSWFVAIHTNIMALLPQVLAELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLM    281 - 350
AVTEKDLLLYDCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVE    351 - 420
THRDLSSWTRILVQGCHAAAELIKEVSLGCMLNGQEVRLTIHYENGFTISRENGGSSSILYRYPFERLKM    421 - 490
SADDGIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV                        491 - 540
//

Text Mined References (41)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24234652 2014 LRP4 third ?-propeller domain mutations cause novel congenital myasthenia by compromising agrin-mediated MuSK signaling in a position-specific manner.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22735534 2012 Equilibrium unfolding of the PDZ domain of ?2-syntrophin.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...