Property Summary

NCBI Gene PubMed Count 48
PubMed Score 31.44
PubTator Score 14.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.089 4.9e-06
adult high grade glioma -1.300 1.9e-03
Astrocytoma, Pilocytic -1.400 8.0e-07
atypical teratoid / rhabdoid tumor -1.300 8.6e-05
breast carcinoma -1.500 1.7e-04
fibroadenoma -1.400 4.1e-02
glioblastoma -1.400 2.9e-06
group 3 medulloblastoma -1.900 1.8e-05
medulloblastoma, large-cell -2.000 1.9e-04
osteosarcoma 1.681 3.0e-04
primitive neuroectodermal tumor -1.600 7.8e-04

 OMIM Phenotype (1)

Gene RIF (16)

AA Sequence

MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEP      1 - 70
GAGPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNG     71 - 140
EDLSSATHDEAVQVLKKTGKEVVLEVKYMKDVSPYFKNSTGGTSVGWDSPPASPLQRQPSSPGPTPRNFS    141 - 210
EAKHMSLKMAYVSKRCTPNDPEPRYLEICSADGQDTLFLRAKDEASARSWATAIQAQVNTLTPRVKDELQ    211 - 280
ALLAATSTAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLLYLSLPETREALSRPARTAPLIATRLVH    281 - 350
SGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRP    351 - 420
CSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFGGAEGEIQLDLHSCPKTIVFII    421 - 490
HSFLSAKVTRLGLLA                                                           491 - 505
//

Text Mined References (52)

PMID Year Title