Property Summary

NCBI Gene PubMed Count 47
Grant Count 21
R01 Count 15
Funding $1,506,777.41
PubMed Score 31.74
PubTator Score 14.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.681 0.000
glioblastoma -1.400 0.000
group 4 medulloblastoma -2.100 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.600 0.001
acute quadriplegic myopathy -1.089 0.000
breast carcinoma -1.500 0.000
fibroadenoma -1.400 0.041
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.400 0.000

Gene RIF (15)

PMID Text
27028743 A novel SNTA1 variant is likely causative for drug induced long-QT syndrome by augmenting the late sodium current.
25757662 In a nonreferred nationwide Danish cohort of SIDS cases, up to 5/66 (7.5%) of SIDS cases can be explained by genetic variants in the sodium channel complex genes.
24434436 our results present a possible mechanism of Rac1 activation involving SNTA1 and emphasise its role in ROS generation, cell migration, and acquisition of malignancy.
24235139 alpha-Syntrophin, which resides in nuclei of myocytes, functions as the upstream mediator of nuclear nNOS translocation and nNOS-dependent mitochondrial biogenesis.
24014171 Ordered disorder of the astrocytic dystrophin-associated protein complex in the norm and pathology.
23426965 Calcium homeostasis mishandling in Duchenne muscular dystrophy myotubes depends on store operated calcium entry under the influence alpha1-syntrophin regulation as well as TRPV2-dependant cation influx.
23376825 The combined mutations of A261V-SNTA1 plus R800L-SCN5A increase the INa current late/peak ratio and time constants of current decay.
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntrophin
21091386 In contrast to stomach, lung, colon and rectal cancers, SNTA1 protein was found to be downregulated in esophageal cancers and upregulated in breast cancer.
20009079 Alpha1-syntrophin mutations identified in sudden infant death syndrome cause an increase in late cardiac sodium current.
More...

AA Sequence

MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEP      1 - 70
GAGPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNG     71 - 140
EDLSSATHDEAVQVLKKTGKEVVLEVKYMKDVSPYFKNSTGGTSVGWDSPPASPLQRQPSSPGPTPRNFS    141 - 210
EAKHMSLKMAYVSKRCTPNDPEPRYLEICSADGQDTLFLRAKDEASARSWATAIQAQVNTLTPRVKDELQ    211 - 280
ALLAATSTAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLLYLSLPETREALSRPARTAPLIATRLVH    281 - 350
SGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRP    351 - 420
CSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFGGAEGEIQLDLHSCPKTIVFII    421 - 490
HSFLSAKVTRLGLLA                                                           491 - 505
//

Text Mined References (51)

PMID Year Title
27028743 2016 ?1-Syntrophin Variant Identified in Drug-Induced Long QT Syndrome Increases Late Sodium Current.
25757662 2015 The role of the sodium current complex in a nonreferred nationwide cohort of sudden infant death syndrome.
24434436 2014 Role of SNTA1 in Rac1 activation, modulation of ROS generation, and migratory potential of human breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24235139 2014 Nuclear recruitment of neuronal nitric-oxide synthase by ?-syntrophin is crucial for the induction of mitochondrial biogenesis.
24014171 2013 Ordered disorder of the astrocytic dystrophin-associated protein complex in the norm and pathology.
23426965 2013 Involvement of TRPV2 and SOCE in calcium influx disorder in DMD primary human myotubes with a specific contribution of ?1-syntrophin and PLC/PKC in SOCE regulation.
23376825 2013 Digenic inheritance novel mutations in SCN5a and SNTA1 increase late I(Na) contributing to LQT syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21164104 2011 SAP97 and dystrophin macromolecular complexes determine two pools of cardiac sodium channels Nav1.5 in cardiomyocytes.
More...