Property Summary

NCBI Gene PubMed Count 28
PubMed Score 309.23
PubTator Score 19.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.302 8.4e-03
Alzheimer's disease -1.200 4.3e-02
dermatomyositis -1.400 2.0e-02
gastric carcinoma -1.200 3.9e-02
hereditary spastic paraplegia -1.219 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.5e-02
invasive ductal carcinoma -1.100 1.1e-02
lung adenocarcinoma 1.068 9.6e-06
malignant mesothelioma -6.200 8.7e-10
non-small cell lung cancer 1.128 1.1e-09
ovarian cancer 1.100 2.2e-03
pancreatic ductal adenocarcinoma liver m... -1.874 1.9e-03
Pick disease -1.600 1.1e-04

Gene RIF (10)

AA Sequence

MANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEK      1 - 70
RVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVH     71 - 140
EADLLKTSGTLISFIYPAQNPELLNKLSQRKTTVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANH    141 - 210
FGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKE    211 - 280
SGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFNKEMIESMKEGSVVVDLAAEA    281 - 350
GGNFETTKPGELYIHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISPDKDNFYFDVKDDFDFGTMG    351 - 420
HVIRGTVVMKDGKVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMSTASAYTAGLTGILGLG    421 - 490
IAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGGHLYPSTTSQGLA    491 - 560
ALAAFISSVNIAGGFLVTQRMLDMFKRPTDPPEYNYLYLLPAGTFVGGYLAALYSGYNIEQIMYLGSGLC    561 - 630
CVGALAGLSTQGTARLGNALGMIGVAGGLAATLGVLKPGPELLAQMSGAMALGGTIGLTIAKRIQISDLP    631 - 700
QLVAAFHSLVGLAAVLTCIAEYIIEYPHFATDAAANLTKIVAYLGTYIGGVTFSGSLIAYGKLQGLLKSA    701 - 770
PLLLPGRHLLNAGLLAASVGGIIPFMVDPSFTTGITCLGSVSALSAVMGVTLTAAIGGADMPVVITVLNS    771 - 840
YSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRSLANVILGGYGTTSTAGGKPMEISGTHT    841 - 910
EINLDNAIDMIREANSIIITPGYGLCAAKAQYPIADLVKMLTEQGKKVRFGIHPVAGRMPGQLNVLLAEA    911 - 980
GVPYDIVLEMDEINHDFPDTDLVLVIGANDTVNSAAQEDPNSIIAGMPVLEVWKSKQVIVMKRSLGVGYA    981 - 1050
AVDNPIFYKPNTAMLLGDAKKTCDALQAKVRESYQK                                     1051 - 1086
//

Text Mined References (33)

PMID Year Title