Property Summary

NCBI Gene PubMed Count 238
PubMed Score 643.33
PubTator Score 387.20

Knowledge Summary

Patent (37,703)


  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 4.48560589805075E-6
osteosarcoma 7933 0.00228336057546641
Rheumatoid Arthritis 1171 0.00861149917388899
Disease Target Count Z-score Confidence
Cancer 2346 4.612 2.3
Kidney disease 397 3.725 1.9


  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.009
osteosarcoma -1.067 0.002
ovarian cancer 2.100 0.000


Accession Q13418 B7Z1I0 B7Z418 D3DQU0 P57043 Q68DZ3
Symbols P59




3KMU   3KMW   3REP   2KBX   3F6Q   3IXE   4HI8   4HI9  

  Ortholog (12)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (183)

26693891 Twist-ITGB1-FAK/ILK pathway and their downstream signaling network dictate the Twist-induced EMT process in human mammary epithelial cells and breast cancer cells
26549818 integrin linked kinase may play a role in cell proliferation, and cell migration in aggressive thyroid cancers.
26531674 Results indicated that ILK is imperative in the development and progression of oral squamous cell carcinoma.
26467393 high extracellular concentration of phosphate induced senescence in cultured smooth muscle through the activation of IGF-1 receptor and ILK overexpression
26460618 our data suggest an essential role of PINCH1, ILK and ILKAP for the radioresistance of p53-wildtype glioblastoma multiforme cells
26210487 Overexpression of ILK is associated with arteriosclerosis.
26176204 ILK inhibition and knockdown effects senescence in an Rb-dependent manner.
25998224 knockdown of ILK inhibits glioma cell migration, invasion and proliferation through upregulation of E-cadherin and downregulation of cyclin D1. Our results suggest that ILK may serve as a promising therapeutic target for glioma.
25964055 ILK may have an important role in the progression of NSCLC, possibly through up-regulation of Snail and MRP1.
25805567 Overexpression of CD29 decreased E-cadherin, but increased fibronectin, vimentin, ILK activity.

AA Sequence

VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK                                          421 - 452

Text Mined References (247)

PMID Year Title
26693891 2016 Twist induces epithelial-mesenchymal transition and cell motility in breast cancer via ITGB1-FAK/ILK signaling axis and its associated downstream network.
26549818 2016 Integrin-linked kinase affects signaling pathways and migration in thyroid cancer cells and is a potential therapeutic target.
26531674 2016 Effects of lentivirus-mediated shRNA targeting integrin-linked kinase on oral squamous cell carcinoma in vitro and in vivo.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26467393 2015 Hyperphosphatemia induces cellular senescence in human aorta smooth muscle cells through integrin linked kinase (ILK) up-regulation.
26460618 2015 ILKAP, ILK and PINCH1 control cell survival of p53-wildtype glioblastoma cells after irradiation.
26210487 2015 Advanced glycation end products accelerate arteriosclerosis after renal transplantation through the AGE/RAGE/ILK pathway.
26176204 2015 Integrin-linked kinase regulates senescence in an Rb-dependent manner in cancer cell lines.
25998224 2015 Knockdown of ILK inhibits glioma development via upregulation of E-cadherin and downregulation of cyclin D1.
25964055 2015 Integrin-Linked Kinase, Snail and Multidrug Resistance Protein 1: Three concordant players in the progression of non-small cell lung cancer.