Property Summary

Ligand Count 6
NCBI Gene PubMed Count 263
PubMed Score 679.07
PubTator Score 387.20

Knowledge Summary

Patent (37,703)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.067 2.3e-03
ovarian cancer -1.200 2.7e-09
Rheumatoid arthritis -1.300 8.6e-03

Protein-protein Interaction (5)

Gene RIF (204)

AA Sequence

MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP      1 - 70
LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA     71 - 140
KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG    141 - 210
RWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNV    211 - 280
LHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRM    281 - 350
YAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH    351 - 420
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK                                          421 - 452
//

Text Mined References (273)

PMID Year Title