Property Summary

NCBI Gene PubMed Count 62
PubMed Score 4.92
PubTator Score 46.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 1.5e-04
glioblastoma -1.100 6.3e-04
group 3 medulloblastoma 1.400 4.2e-05
intraductal papillary-mucinous adenoma (... 1.400 8.7e-03
intraductal papillary-mucinous carcinoma... 1.300 2.1e-02
lung cancer 1.500 2.3e-04
medulloblastoma, large-cell 1.100 2.9e-04
osteosarcoma -2.008 2.5e-07
ovarian cancer -1.700 5.8e-08
psoriasis -1.700 2.6e-04

Gene RIF (15)

AA Sequence

MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNY      1 - 70
VEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSK     71 - 140
GHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEEDTNAVIFSQK    141 - 210
IQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVS    211 - 280
PSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKS    281 - 350
VLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYL    351 - 420
IASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARG    421 - 490
IFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIP    491 - 560
VDNGTLTDFLEKEEEEA                                                         561 - 577
//

Text Mined References (71)

PMID Year Title