Property Summary

NCBI Gene PubMed Count 56
Grant Count 20
R01 Count 14
Funding $2,096,983.89
PubMed Score 3.38
PubTator Score 46.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 0.000
psoriasis -1.700 0.000
osteosarcoma -2.008 0.000
group 3 medulloblastoma 1.400 0.000
glioblastoma -1.100 0.001
medulloblastoma, large-cell 1.100 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.009
intraductal papillary-mucinous carcinoma... 1.300 0.021
lung cancer 1.600 0.003
ovarian cancer -1.700 0.000

Gene RIF (12)

PMID Text
24792176 Protein phosphatase 1 dephosphorylates Orc2 to promote the binding of ORC to chromatin and replication origins for the subsequent round of the cell cycle.
24732362 These results suggest that PP1 dephosphorylates Orc2 to promote the binding of ORC to chromatin.
23188630 Gemcitabine resistance is dependent on Plk1-mediated phosphorylation of Orc2 and Hbo1.
22935713 Orc2 protects ORCA from ubiquitin-mediated degradation in vivo.
22334659 The phosphorylation of ORC2 dissociates origin recognition complex (ORC) from chromatin and replication origins and inhibits binding of ORC to newly replicated DNA.
21947279 Plk1 phosphorylation of Orc2 promotes DNA replication under conditions of stress
16762929 human Orc2 has specific domains that are required in vivo for assembly and nuclear localization of the origin recognition complex
16407251 The low level of Orc2 in Orc2 hypomorphic cells hinders normal cell cycle progression by delaying the activation of G1 cyclin-dependent kinases.
15910003 Study using HCT116 haplo-insufficient cells and Orc2 hypomorphic cells demonstrates that human Ku80 and Orc2 bind to replication origins independently of each other.
12912926 The precise nucleotide of binding for ORC2 was identified near the stgart site for leading-strand synthesis; the transition to the post-replicative complex is accompanied by a 17 bp displacement of ORC2 towards the start site.
More...

AA Sequence

MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNY      1 - 70
VEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSK     71 - 140
GHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEEDTNAVIFSQK    141 - 210
IQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVS    211 - 280
PSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKS    281 - 350
VLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYL    351 - 420
IASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARG    421 - 490
IFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIP    491 - 560
VDNGTLTDFLEKEEEEA                                                         561 - 577
//

Text Mined References (65)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24989122 2014 A role for DNA polymerase ? in the timing of DNA replication.
24792176 2014 Dephosphorylation of Orc2 by protein phosphatase 1 promotes the binding of the origin recognition complex to chromatin.
24732362 2014 Protein phosphatase 1 dephosphorylates Orc2.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23188630 2013 Plk1 phosphorylation of orc2 and hbo1 contributes to gemcitabine resistance in pancreatic cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22935713 2012 Orc2 protects ORCA from ubiquitin-mediated degradation.
22645314 2012 Dynamic association of ORCA with prereplicative complex components regulates DNA replication initiation.
More...