Property Summary

NCBI Gene PubMed Count 58
Grant Count 28
R01 Count 19
Funding $3,471,824.41
PubMed Score 27.94
PubTator Score 66.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
osteosarcoma -2.205 0.000
glioblastoma 1.400 0.001
group 3 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.400 0.002
non-small cell lung cancer 1.077 0.000
pediatric high grade glioma 1.300 0.000
psoriasis 1.400 0.000

Gene RIF (22)

PMID Text
25784553 Orc1 acts as a nucleating center for origin recognition complex assembly and then pre-replication complex assembly by binding to mitotic chromosomes, followed by gradual removal from chromatin during the G1 phase.
24003239 ORC1 harbors a G-rich RNA/ssDNA-binding domain, which may be involved in the preferential binding to G-quadruplex-formable RNA/DNA by ORC. Structure modeling predicts the structural similarity between the G-rich RNA/ssDNA-binding domain of ORC1 and part of mammalian DNA methyltransferase 1.
23187890 ORC1 associated with transcription start sites of coding or noncoding RNAs. Transcription levels at the ORC1 sites directly correlated with replication timing.
22855792 Orc1 harbors a PACT centrosome-targeting domain and a separate domain that differentially inhibits the protein kinase activities of Cyclin E-CDK2 and Cyclin A-CDK2
22589552 Data show that purified Epstein-Barr nuclear antigen 1 EBNA1 recruits purified Human Orc1 and Cdc6 onto replication origin oriP.
22398447 results identify the BAH domain as a novel methyl-lysine-binding module, thereby establishing the first direct link between histone methylation and the metazoan DNA replication machinery, and defining a pivotal aetiological role for the canonical H4K20me2 mark, via ORC1, in primordial dwarfism
22333897 A lethal phenotype was seen in four individuals with compound heterozygous ORC1 mutations
22045277 As cells moved through the cell cycle, the local-ization of ORC1 shifted, suggesting changes in thelocalization of ORC-bound origin sequences.
21358633 Mutations in ORC1, encoding a subunit of the origin recognition complex, cause microcephalic primordial dwarfism resembling Meier-Gorlin syndrome. These mutations disrupt ORC1 functions including pre-replicative complex formation and origin activation.
21115485 in human cancer cells, RBX1 silencing causes the accumulation of DNA replication licensing proteins CDT1 and ORC1, leading to DNA double-strand breaks, DDR, G(2) arrest, and, eventually, aneuploidy
More...

AA Sequence

MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLE      1 - 70
LFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPACDSNINAETIIGLVRVIPLAP     71 - 140
KDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESPSWTPAEHVAK    141 - 210
RIESRHSASKSRQTPTHPLTPRARKRLELGNLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQP    211 - 280
DKLQTLSPALKAPEKTRETGLSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPS    281 - 350
VILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSS    351 - 420
SDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLAAQEPASVLEE    421 - 490
ARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDV    491 - 560
PPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQ    561 - 630
DIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAF    631 - 700
EDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNS    701 - 770
SVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRND    771 - 840
LLLRVRLNVSQDDVLYALKDE                                                     841 - 861
//

Text Mined References (65)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25784553 2015 Orc1 Binding to Mitotic Chromosomes Precedes Spatial Patterning during G1 Phase and Assembly of the Origin Recognition Complex in Human Cells.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24003239 2013 Human origin recognition complex binds preferentially to G-quadruplex-preferable RNA and single-stranded DNA.
23187890 2013 Genome-wide mapping of human DNA-replication origins: levels of transcription at ORC1 sites regulate origin selection and replication timing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22855792 2012 Meier-Gorlin syndrome mutations disrupt an Orc1 CDK inhibitory domain and cause centrosome reduplication.
22645314 2012 Dynamic association of ORCA with prereplicative complex components regulates DNA replication initiation.
22589552 2012 Epstein-Barr nuclear antigen 1 (EBNA1)-dependent recruitment of origin recognition complex (Orc) on oriP of Epstein-Barr virus with purified proteins: stimulation by Cdc6 through its direct interaction with EBNA1.
22398447 2012 The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.
More...