Property Summary

NCBI Gene PubMed Count 10
PubMed Score 555.08
PubTator Score 19.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 3.7e-02
ovarian cancer 1.300 2.8e-04

Synonym

Accession Q13405 B2R4G6 L49mt
Symbols NOF
NOF1
L49mt
C11orf4
MRP-L49

Gene

PDB

3J9M   3J7Y   5OOL   5OOM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVERLLPATRIPDPPKHEHYPTPS      1 - 70
GWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQV     71 - 140
NEVTGTLRIKGYFDQELKAWLLEKGF                                                141 - 166
//

Text Mined References (13)

PMID Year Title