Property Summary

NCBI Gene PubMed Count 37
PubMed Score 18.04
PubTator Score 30.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

AA Sequence

MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIE      1 - 70
CGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPP     71 - 140
EGQCYSN                                                                   141 - 147
//

Text Mined References (41)

PMID Year Title