Property Summary

NCBI Gene PubMed Count 35
Grant Count 8
R01 Count 4
Funding $347,135.75
PubMed Score 16.26
PubTator Score 30.25

Knowledge Summary

Patent

No data available

Expression

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2658 confirmatory 30 / 0 / 84 SAR analysis of Ubc13-Ubiquitination selectivity in a TR-FRET assay for In Vitro dose response studies
485351 confirmatory 38 / 0 / 50 SAR analysis of Ubc13-Ubiquitination selectivity in a TR-FRET assay for In Vitro dose response studies - set 2

Gene RIF (11)

PMID Text
25022892 Ubiquitin-conjugating enzyme complex Uev1A-Ubc13 promotes breast cancer metastasis through nuclear factor-small ka, CyrillicB mediated matrix metalloproteinase-1 gene regulation.
22632162 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21866272 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21575904 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21572451 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21512573 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21512569 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
17709375 modification of proteins with Lys(63)-linked ubiquitin chains occurs through a UEV1A-independent substrate modification and UEV1A-dependent Lys(63)-linked ubiquitin chain synthesis mechanism
17041755 These data provide evidence that Uev1A is a critical regulatory component in the NF-kappaB signaling pathway in response to environmental stresses and identify UEV1A as a potential proto-oncogene.
16893187 A structural model for the Ub-hUev1a-hUbc13-Ub tetramer was developed to gain chemical insight into the synthesis of Lys(63)-linked Ubiquitin chains.
More...

AA Sequence

MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIE      1 - 70
CGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPP     71 - 140
EGQCYSN                                                                   141 - 147
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
25022892 2014 Ubiquitin-conjugating enzyme complex Uev1A-Ubc13 promotes breast cancer metastasis through nuclear factor-?B mediated matrix metalloproteinase-1 gene regulation.
24076975 2013 The tomato Fni3 lysine-63-specific ubiquitin-conjugating enzyme and suv ubiquitin E2 variant positively regulate plant immunity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
21512573 2011 TRIM5 is an innate immune sensor for the retrovirus capsid lattice.
More...