Property Summary

NCBI Gene PubMed Count 35
PubMed Score 16.26
PubTator Score 30.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13404 E1P629 Q13403 Q13532 Q5TGE0 Q5TGE3 Q96H34 Q9GZT0 Q9GZW1 Q9H4J3 Q9H4J4 Q9UKL1 Q9UM48 Q9UM49 Q9UM50 UEV-1
Symbols CIR1
UEV1
CROC1
UBE2V
UEV-1
UEV1A
CROC-1

Gene

PDB

2A4D   2C2V   2HLW  

  Ortholog (12)

Species Source
Chimp OMA Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2658 confirmatory 30 / 0 / 84 SAR analysis of Ubc13-Ubiquitination selectivity in a TR-FRET assay for In Vitro dose response studies
485351 confirmatory 38 / 0 / 50 SAR analysis of Ubc13-Ubiquitination selectivity in a TR-FRET assay for In Vitro dose response studies - set 2

Gene RIF (11)

PMID Text
25022892 Ubiquitin-conjugating enzyme complex Uev1A-Ubc13 promotes breast cancer metastasis through nuclear factor-small ka, CyrillicB mediated matrix metalloproteinase-1 gene regulation.
22632162 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21866272 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21575904 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21572451 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21512573 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
21512569 Heterodimeric E2 UBC13-UEV1A and the arginine 63-linked ubiquitin chains play a role in TRIM5alpha-mediated signaling, which leads to capsid-specific restriction
17709375 modification of proteins with Lys(63)-linked ubiquitin chains occurs through a UEV1A-independent substrate modification and UEV1A-dependent Lys(63)-linked ubiquitin chain synthesis mechanism
17041755 These data provide evidence that Uev1A is a critical regulatory component in the NF-kappaB signaling pathway in response to environmental stresses and identify UEV1A as a potential proto-oncogene.
16893187 A structural model for the Ub-hUev1a-hUbc13-Ub tetramer was developed to gain chemical insight into the synthesis of Lys(63)-linked Ubiquitin chains.
More...

AA Sequence

MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIE      1 - 70
CGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPP     71 - 140
EGQCYSN                                                                   141 - 147
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
25022892 2014 Ubiquitin-conjugating enzyme complex Uev1A-Ubc13 promotes breast cancer metastasis through nuclear factor-?B mediated matrix metalloproteinase-1 gene regulation.
24076975 2013 The tomato Fni3 lysine-63-specific ubiquitin-conjugating enzyme and suv ubiquitin E2 variant positively regulate plant immunity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
21512573 2011 TRIM5 is an innate immune sensor for the retrovirus capsid lattice.
More...