Property Summary

NCBI Gene PubMed Count 5
PubMed Score 309.34

Knowledge Summary

Patent

No data available

Synonym

Accession Q13401 A6NG70 Q3MJ29
Symbols PMS5
PMSR3
PMS2L3
PMS2L9

Gene

Gene RIF (1)

PMID Text
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MNTLQGPVSFKDVAVDFTQEEWRQLDPDEKIAYGDVMLENYSHLVSVGYDYHQAKHHHGVEVKEVEQGEE      1 - 70
PWIMEGEFPCQHSPEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDL     71 - 140
IEVSDNGCGVEEENFEGLISFSSETSHM                                              141 - 168
//

Text Mined References (7)

PMID Year Title
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8586419 1995 Genomic organization of the human PMS2 gene family.
7980603 1994 Cloning, characterization and chromosomal assignment of the human genes homologous to yeast PMS1, a member of mismatch repair genes.