Property Summary

NCBI Gene PubMed Count 5
PubMed Score 339.47

Knowledge Summary

Patent

No data available

Synonym

Accession Q13401 A6NG70 Q3MJ29
Symbols PMS5
PMSR3
PMS2L3
PMS2L9

Gene

 GO Component (1)

Gene RIF (1)

AA Sequence

MNTLQGPVSFKDVAVDFTQEEWRQLDPDEKIAYGDVMLENYSHLVSVGYDYHQAKHHHGVEVKEVEQGEE      1 - 70
PWIMEGEFPCQHSPEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDL     71 - 140
IEVSDNGCGVEEENFEGLISFSSETSHM                                              141 - 168
//

Text Mined References (7)

PMID Year Title