Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
R01 Count 2
Funding $341,033.67
PubMed Score 11.41
PubTator Score 12.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13395 Q9H581
Symbols TRM3
TRP185
TRP-185

Gene

PDB

2HA8  

Gene RIF (15)

PMID Text
26464651 TARBP1 is up-regulated in hepatocellular carcinoma, and the expression of TARBP1 was associated with the pathological grading and clinical stage.
25421511 TARBP1 is positively regulated by MIR10A and MIR21 which are upregulated in heavy drinkers following psychological stress.
22025453 DGCR8, AGO1, AGO2, PACT, and TARBP1 expression levels were significantly higher in the epithelial skin cancer groups than the healthy controls (P > 0.05).
21294215 HIV-1 Tat downregulates TAR (HIV) RNA binding protein 1 in HEK 293T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19422693 Binding of Dicer to TRBPs is critical for RNAi function.
18412263 The crystal structure of methyltransferase domain of human TARBP1 protein in complex with S-adenosyl-L-homocysteine (AdoHcy) at 1.6-A resolution, is reported.
18051367 HIV-1 Tat downregulates TAR (HIV) RNA binding protein 1 in HEK 293T cells
17360756 HIV-1 Tat downregulates TAR (HIV) RNA binding protein 1 in HEK 293T cells
12458222 induces induction of HIV-1 long terminal repeat by human and murine cyclin T1 and requires Sp1.
More...

AA Sequence

MEWVLAEALLSQSRDPRALLGALCQGEASAERVETLRFLLQRLEDEEARGSGGAGALPEAAREVAAGYLV      1 - 70
PLLRSLRGRPAGGPDPSLQPRHRRRVLRAAGAALRSCVRLAGRPQLAAALAEEALRDLLAGWRAPGAEAA     71 - 140
VEVLAAVGPCLRPREDGPLLERVAGTAVALALGGGGDGDEAGPAEDAAALVAGRLLPVLVQCGGAALRAV    141 - 210
WGGLAAPGASLGSGRVEEKLLVLSALAEKLLPEPGGDRARGAREAGPDARRCWRFWRTVQAGLGQADALT    211 - 280
RKRARYLLQRAVEVSAELGADCTCGPQEGNGPSLFWWSERKKDELLKFWENYILIMETLEGNQIHVIKPV    281 - 350
LPKLNNLFEYAVSEENGCWLFHPSWHMCIYKRMFESENKILSKEGVIHFLELYETKILPFSPEFSEFIIG    351 - 420
PLMDALSESSLYSRSPGQPIGSCSPLGLKLQKFLVTYISLLPEEIKSSFLLKFIRKMTSRHWCAVPILFL    421 - 490
SKALANVPRHKALGIDGLLALRDVIHCTMITHQILLRGAAQCYLLQTAMNLLDVEKVSLSDVSTFLMSLR    491 - 560
QEESLGRGTSLWTELCDWLRVNESYFKPSPTCSSIGLHKTSLNAYVKSIVQEYVKSSAWETGENCFMPDW    561 - 630
FEAKLVSLMVLLAVDVEGMKTQYSGKQRTENVLRIFLDPLLDVLMKFSTNAYMPLLKTDRCLQLLLKLLN    631 - 700
TCRLKGSSAQDDEVSTVLQNFFMSTTESISEFILRRLTMNELNSVSDLDRCHLYLMVLTELINLHLKVGW    701 - 770
KRGNPIWRVISLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAGPLES    771 - 840
FLSSLQLNQTLQKPHAEEQSSYAHPLECSSVLEESSSSQGWGKIVAQYIHDQWVCLSFLLKKYHTLIPTT    841 - 910
GSEILEPFLPAVQMPIRTLQSALEALTVLSSDQVLPVFHCLKVLVPKLLTSSESLCIESFDMAWKIISSL    911 - 980
SNTQLIFWANLKAFVQFVFDNKVLTIAAKIKGQAYFKIKEIMYKIIEMSAIKTGVFNTLISYCCQSWIVS    981 - 1050
ASNVSQGSLSSAKNYSELILEACIFGTVFRRDQRLVQDVQTFIENLGHDCAANIVMENTKREDHYVRICA   1051 - 1120
VKFLCLLDGSNMSHKLFIEDLAIKLLDKDELVSKSKKRYYVNSLQHRVKNRVWQTLLVLFPRLDQNFLNG   1121 - 1190
IIDRIFQAGFTNNQASIKYFIEWIIILILHKFPQFLPKFWDCFSYGEENLKTSICTFLAVLSHLDIITQN   1191 - 1260
IPEKKLILKQALIVVLQWCFNHNFSVRLYALVALKKLWTVCKVLSVEEFDALTPVIESSLHQVESMHGAG   1261 - 1330
NAKKNWQRIQEHFFFATFHPLKDYCLETIFYILPRLSGLIEDEWITIDKFTRFTDVPLAAGFQWYLSQTQ   1331 - 1400
LSKLKPGDWSQQDIGTNLVEADNQAEWTDVQKKIIPWNSRVSDLDLELLFQDRAARLGKSISRLIVVASL   1401 - 1470
IDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSAEQWLPLVEVKPPQLIDYLQQKKTEGYTI   1471 - 1540
IGVEQTAKSLDLTQYCFPEKSLLLLGNEREGIPANLIQQLDVCVEIPQQGIIRSLNVHVSGALLIWEYTR   1541 - 1610
QQLLSHGDTKP                                                              1611 - 1621
//

Text Mined References (19)

PMID Year Title
26464651 2015 Expression of protein TARBP1 in human hepatocellular carcinoma and its prognostic significance.
25421511 2014 Stress-related alcohol consumption in heavy drinkers correlates with expression of miR-10a, miR-21, and components of the TAR-RNA-binding protein-associated complex.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22025453 2012 Expression levels of the microRNA maturing microprocessor complex component DGCR8 and the RNA-induced silencing complex (RISC) components argonaute-1, argonaute-2, PACT, TARBP1, and TARBP2 in epithelial skin cancer.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19422693 2009 Characterization of the TRBP domain required for dicer interaction and function in RNA interference.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18412263 2008 Crystal structure of the methyltransferase domain of human TARBP1.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
More...