Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.69
PubTator Score 8.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma -1.500 6.0e-22
ductal carcinoma in situ -1.500 1.1e-02
group 3 medulloblastoma 6.200 2.7e-04
invasive ductal carcinoma -2.900 8.0e-05
medulloblastoma, large-cell 4.900 1.8e-03
posterior fossa group B ependymoma 1.800 2.3e-02
subependymal giant cell astrocytoma -4.484 6.6e-04

Gene RIF (4)

AA Sequence

MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVIS      1 - 70
PTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAV     71 - 140
DKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNL    141 - 210
LSKECHSLAGKQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSY    211 - 280
ECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREIL    281 - 350
TNPKSLEKL                                                                 351 - 359
//

Text Mined References (18)

PMID Year Title