Property Summary

NCBI Gene PubMed Count 130
PubMed Score 185.14
PubTator Score 185.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.89022590671923E-11
ovarian cancer 8492 3.46627248780867E-8
intraductal papillary-mucinous adenoma (IPMA) 2956 7.89734939620388E-6
adrenocortical carcinoma 1427 2.85794249831408E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.81735447988098E-5
breast carcinoma 1614 5.54642704042508E-5
pancreatic cancer 2300 1.29500580056774E-4
Breast cancer 3099 1.70057801102683E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.72525093139912E-4
ulcerative colitis 2087 4.47593309348286E-4
colon cancer 1475 5.97614280009043E-4
osteosarcoma 7933 0.00241937291023175
pituitary cancer 1972 0.00338892918041909
pterygium 74 0.00703334877852061
non primary Sjogren syndrome sicca 840 0.00858301973500683
group 4 medulloblastoma 1875 0.0103987702144768
tuberculosis 1563 0.013879557195118
oligodendroglioma 2849 0.0153393507527995
ependymoma 2514 0.016223860460529
progressive supranuclear palsy 674 0.0166464118470351
lung cancer 4473 0.0181258615472682
cystic fibrosis and chronic rhinosinusitis 213 0.0288551583999337
esophageal adenocarcinoma 737 0.040395215713209
spina bifida 1064 0.0409323319619009

Expression

  Differential Expression (24)

Synonym

Accession Q13393 PLD 1
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
602144 screening 111 / 0 / 313 Cellular PLD1 isoenzyme activity assays at set concentration
602150 confirmatory 25 / 0 / 0 PLD1 purified enzyme concentration response
602151 confirmatory 144 / 0 / 3 Cellular PLD1 concentration response
602153 other 3 / 0 / 0 ML270, ML271, ML272 Competition in Radioligand Binding assays (Ricerca)
624001 confirmatory 2 / 0 / 0 PLD1 purified enzyme concentration response (PLD1_Assay_3A_Lib32)
624003 confirmatory 10 / 0 / 0 PLD1 Cellular concentration response (PLD1_Assay_2A_Lib32)
624008 screening 10 / 0 / 18 PLD1 Cellular isoenzyme activity (PLD1_Assay_1A_Lib32)
743388 screening 15 / 0 / 65 Identifying inhibitors with PLD1 specific Cellular Isoenzyme Activity
743389 confirmatory 21 / 0 / 0 PLD1 Cellular Concentration Response Study
743390 confirmatory 3 / 0 / 0 PLD1 Inhibitor Confirmatory assay using the Purified Enzyme Concentration Response Method

Gene RIF (98)

PMID Text
26680696 These findings reveal a novel role of the PLD1-pleckstrin homology domain as a positive regulator of endocytosis and provide a link between PLD1 and HIF-1alpha in the EGFR endocytosis pathway.
26335962 Our data extend the knowledge for a variety of possible roles of PLD1 in allergic disorders including asthma pathogenesis
26250158 MicroRNA-638 inhibits cell proliferation by targeting phospholipase D1 in human gastric carcinoma
25523098 Ectopic expression of PLD1 or PLD2 in human glioma U87 cells increased the expression of hypoxia-inducible factor-1alpha protein.
25489735 PED/PEA-15 overexpression is sufficient to block hydrogen peroxide-induced apoptosis in Ins-1E cells through a PLD-1 mediated mechanism
25361009 These observations define a novel function of PLD1 as a previously unrecognized HIF-1alpha regulator.
25197077 PLCdelta1 has tumor-suppressive functions in colorectal cancer through E-cadherin induction.
25172550 Results indicate distinctive roles of phospholipase D PLD1 and PLD2 isoforms in pathological conditions in retinal pigment epithelium (RPE).
24990946 Cellular and physiological roles for phospholipase D1 in cancer.
24802400 The present study indicates that PLD1 plays a role in regulating type I collagen accumulation through induction of autophagy.
More...

AA Sequence

MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEP      1 - 70
NIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHRELLKYKAFIRIP     71 - 140
IPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRRKQLEDYLTKILKMPMYRNYHATTEFLDISQ    141 - 210
LSFIHDLGPKGIEGMIMKRSGGHRIPGLNCCGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDK    211 - 280
EFKIKVGKKETETKYGIRIDNLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENA    281 - 350
LAKWYVNAKGYFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY    351 - 420
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDN    421 - 490
EHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKSIDDVDSKLKGIGKPRKFSKF    491 - 560
SLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGLKPHFKLFHPSSESEQGLTRPHADTGSIRSL    561 - 630
QTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQR    631 - 700
WNFTKIMKSKYRSLSYPFLLPKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVI    701 - 770
ENSRHYIYIENQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ    771 - 840
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIG    841 - 910
SANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSEDIQDPVSD    911 - 980
KFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFY    981 - 1050
FLSEESLLPSVGTKEAIVPMEVWT                                                 1051 - 1074
//

Text Mined References (134)

PMID Year Title
26680696 2015 The pleckstrin homology domain of phospholipase D1 accelerates EGFR endocytosis by increasing the expression of the Rab5 effector, rabaptin-5.
26335962 2015 The TLR4-associated phospholipase D1 activation is crucial for Der f 2-induced IL-13 production.
26250158 2015 MicroRNA-638 inhibits cell proliferation by targeting phospholipase D1 in human gastric carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25523098 2014 Phospholipase D activates HIF-1-VEGF pathway via phosphatidic acid.
25489735 2014 PED/PEA-15 inhibits hydrogen peroxide-induced apoptosis in Ins-1E pancreatic beta-cells via PLD-1.
25361009 2014 Phospholipase D1 protein coordinates dynamic assembly of HIF-1?-PHD-VHL to regulate HIF-1? stability.
25197077 2014 Phospholipase C?1 induces E-cadherin expression and suppresses malignancy in colorectal cancer cells.
25172550 2014 The phospholipase D pathway mediates the inflammatory response of the retinal pigment epithelium.
24990946 2014 Cellular and physiological roles for phospholipase D1 in cancer.
More...