Property Summary

NCBI Gene PubMed Count 130
Grant Count 114
R01 Count 92
Funding $10,613,704.37
PubMed Score 185.14
PubTator Score 185.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Synonym

Accession Q13393 PLD 1
Symbols

Gene

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
602144 screening 111 / 0 / 313 Cellular PLD1 isoenzyme activity assays at set concentration
602150 confirmatory 25 / 0 / 0 PLD1 purified enzyme concentration response
602151 confirmatory 144 / 0 / 3 Cellular PLD1 concentration response
602153 other 3 / 0 / 0 ML270, ML271, ML272 Competition in Radioligand Binding assays (Ricerca)
624001 confirmatory 2 / 0 / 0 PLD1 purified enzyme concentration response (PLD1_Assay_3A_Lib32)
624003 confirmatory 10 / 0 / 0 PLD1 Cellular concentration response (PLD1_Assay_2A_Lib32)
624008 screening 10 / 0 / 18 PLD1 Cellular isoenzyme activity (PLD1_Assay_1A_Lib32)
743388 screening 15 / 0 / 65 Identifying inhibitors with PLD1 specific Cellular Isoenzyme Activity
743389 confirmatory 21 / 0 / 0 PLD1 Cellular Concentration Response Study
743390 confirmatory 3 / 0 / 0 PLD1 Inhibitor Confirmatory assay using the Purified Enzyme Concentration Response Method

Gene RIF (98)

PMID Text
26680696 These findings reveal a novel role of the PLD1-pleckstrin homology domain as a positive regulator of endocytosis and provide a link between PLD1 and HIF-1alpha in the EGFR endocytosis pathway.
26335962 Our data extend the knowledge for a variety of possible roles of PLD1 in allergic disorders including asthma pathogenesis
26250158 MicroRNA-638 inhibits cell proliferation by targeting phospholipase D1 in human gastric carcinoma
25523098 Ectopic expression of PLD1 or PLD2 in human glioma U87 cells increased the expression of hypoxia-inducible factor-1alpha protein.
25489735 PED/PEA-15 overexpression is sufficient to block hydrogen peroxide-induced apoptosis in Ins-1E cells through a PLD-1 mediated mechanism
25361009 These observations define a novel function of PLD1 as a previously unrecognized HIF-1alpha regulator.
25197077 PLCdelta1 has tumor-suppressive functions in colorectal cancer through E-cadherin induction.
25172550 Results indicate distinctive roles of phospholipase D PLD1 and PLD2 isoforms in pathological conditions in retinal pigment epithelium (RPE).
24990946 Cellular and physiological roles for phospholipase D1 in cancer.
24802400 The present study indicates that PLD1 plays a role in regulating type I collagen accumulation through induction of autophagy.
More...

AA Sequence

MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEP      1 - 70
NIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHRELLKYKAFIRIP     71 - 140
IPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRRKQLEDYLTKILKMPMYRNYHATTEFLDISQ    141 - 210
LSFIHDLGPKGIEGMIMKRSGGHRIPGLNCCGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDK    211 - 280
EFKIKVGKKETETKYGIRIDNLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENA    281 - 350
LAKWYVNAKGYFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY    351 - 420
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDN    421 - 490
EHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKSIDDVDSKLKGIGKPRKFSKF    491 - 560
SLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGLKPHFKLFHPSSESEQGLTRPHADTGSIRSL    561 - 630
QTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQR    631 - 700
WNFTKIMKSKYRSLSYPFLLPKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVI    701 - 770
ENSRHYIYIENQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ    771 - 840
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIG    841 - 910
SANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSEDIQDPVSD    911 - 980
KFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFY    981 - 1050
FLSEESLLPSVGTKEAIVPMEVWT                                                 1051 - 1074
//

Text Mined References (134)

PMID Year Title
26680696 2015 The pleckstrin homology domain of phospholipase D1 accelerates EGFR endocytosis by increasing the expression of the Rab5 effector, rabaptin-5.
26335962 2015 The TLR4-associated phospholipase D1 activation is crucial for Der f 2-induced IL-13 production.
26250158 2015 MicroRNA-638 inhibits cell proliferation by targeting phospholipase D1 in human gastric carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25523098 2014 Phospholipase D activates HIF-1-VEGF pathway via phosphatidic acid.
25489735 2014 PED/PEA-15 inhibits hydrogen peroxide-induced apoptosis in Ins-1E pancreatic beta-cells via PLD-1.
25361009 2014 Phospholipase D1 protein coordinates dynamic assembly of HIF-1?-PHD-VHL to regulate HIF-1? stability.
25197077 2014 Phospholipase C?1 induces E-cadherin expression and suppresses malignancy in colorectal cancer cells.
25172550 2014 The phospholipase D pathway mediates the inflammatory response of the retinal pigment epithelium.
24990946 2014 Cellular and physiological roles for phospholipase D1 in cancer.
More...