Property Summary

Ligand Count 85
NCBI Gene PubMed Count 135
PubMed Score 30.92
PubTator Score 185.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.052 5.2e-03
Breast cancer -1.100 1.7e-04
breast carcinoma -1.200 5.5e-05
colon cancer -1.400 6.0e-04
cystic fibrosis and chronic rhinosinusit... 1.059 2.9e-02
ependymoma -1.400 1.6e-02
esophageal adenocarcinoma -1.600 4.0e-02
group 4 medulloblastoma -1.300 1.0e-02
intraductal papillary-mucinous adenoma (... 1.700 7.3e-04
intraductal papillary-mucinous carcinoma... 2.300 4.8e-04
intraductal papillary-mucinous neoplasm ... 3.500 3.8e-05
lung cancer -1.500 1.8e-02
non primary Sjogren syndrome sicca -1.300 8.6e-03
non-small cell lung cancer 1.082 7.5e-11
oligodendroglioma -1.200 1.5e-02
osteosarcoma 1.286 3.7e-04
ovarian cancer -1.600 1.8e-07
pancreatic cancer 1.400 1.3e-04
pituitary cancer 1.400 3.4e-03
progressive supranuclear palsy -1.100 7.6e-03
pterygium -1.500 7.0e-03
spina bifida -1.834 4.9e-02
tuberculosis -1.400 1.4e-02
ulcerative colitis -1.100 4.5e-04

Gene RIF (104)

AA Sequence

MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEP      1 - 70
NIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHRELLKYKAFIRIP     71 - 140
IPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRRKQLEDYLTKILKMPMYRNYHATTEFLDISQ    141 - 210
LSFIHDLGPKGIEGMIMKRSGGHRIPGLNCCGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDK    211 - 280
EFKIKVGKKETETKYGIRIDNLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENA    281 - 350
LAKWYVNAKGYFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY    351 - 420
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDN    421 - 490
EHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKSIDDVDSKLKGIGKPRKFSKF    491 - 560
SLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGLKPHFKLFHPSSESEQGLTRPHADTGSIRSL    561 - 630
QTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQR    631 - 700
WNFTKIMKSKYRSLSYPFLLPKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVI    701 - 770
ENSRHYIYIENQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ    771 - 840
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIG    841 - 910
SANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSEDIQDPVSD    911 - 980
KFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFY    981 - 1050
FLSEESLLPSVGTKEAIVPMEVWT                                                 1051 - 1074
//

Text Mined References (139)

PMID Year Title