Property Summary

NCBI Gene PubMed Count 24
Grant Count 16
R01 Count 16
Funding $1,249,355.44
PubMed Score 506.21
PubTator Score 413.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma -2.300 0.000
osteosarcoma 3.329 0.000
ependymoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.100 0.005
juvenile dermatomyositis -1.164 0.000
pediatric high grade glioma -2.100 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -1.463 0.012
ovarian cancer -1.100 0.000

Gene RIF (2)

PMID Text
21048139 Human IB2 mutation has a role as a contributing genetic factor in chromosome 22-associated cognitive disorders.
12244047 there is a signaling module in which IB2 scaffolds a MLK3/MKK/p38delta kinase cascade.

AA Sequence

MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHP      1 - 70
ICSFQDDFQEFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPAPGPLIPSPSVEEPHKHRPTT     71 - 140
LRLTTLGAQDSLNNNGGFDLVRPASWQETALCSPAPEALRELPGPLPATDTGPGGAQSPVRPGCDCEGNR    141 - 210
PAEPPAPGGTSPSSDPGIEADLRSRSSGGRGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSS    211 - 280
DGGSSSSGRSSHLTNSIEEASSPASEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWL    281 - 350
LSNLVSRMISEGSSPIRCPGQCLSPAPRPPGEPVSPAGGAAQDSQDPEAAAGPGGVELVDMETLCAPPPP    351 - 420
APAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRACSAACSEEEDEEDDEEEEDAEDSAGSPG    421 - 490
GRGTGPSAPRDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGHDSEEDSGGEASEEEAGAALLGGGQVS    491 - 560
GDTSPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLVNGEEREQTHRAVFRFIPRHPDELELDVDDP    561 - 630
VLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNG    631 - 700
ILCAAMQKIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYF    701 - 770
GFITKHPLLSRFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE                    771 - 824
//

Text Mined References (24)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24551779 2012 Evaluation of PKM2 and MAPK8IP2 Polymorphism in Ameloblastic Carcinoma: A Retrospective Quantitative Study.
23225497 2013 Cerebellar and posterior fossa malformations in patients with autism-associated chromosome 22q13 terminal deletion.
21048139 2010 Behavioral and cerebellar transmission deficits in mice lacking the autism-linked gene islet brain-2.
20173330 2010 LRRK2 and the stress response: interaction with MKKs and JNK-interacting proteins.
16456539 2006 A unique set of SH3-SH3 interactions controls IB1 homodimerization.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
More...