Property Summary

NCBI Gene PubMed Count 25
PubMed Score 570.72
PubTator Score 413.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.100 9.3e-08
Astrocytoma, Pilocytic -1.600 1.5e-09
atypical teratoid / rhabdoid tumor -2.200 1.5e-09
ependymoma -1.500 6.5e-12
glioblastoma -1.800 4.9e-10
group 4 medulloblastoma -1.200 4.4e-06
juvenile dermatomyositis -1.164 6.2e-08
medulloblastoma, large-cell -1.500 1.2e-04
osteosarcoma 3.329 1.0e-12
ovarian cancer -1.100 6.7e-06
primitive neuroectodermal tumor -1.100 5.2e-03
subependymal giant cell astrocytoma -1.283 4.5e-02

Gene RIF (2)

AA Sequence

MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHP      1 - 70
ICSFQDDFQEFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPAPGPLIPSPSVEEPHKHRPTT     71 - 140
LRLTTLGAQDSLNNNGGFDLVRPASWQETALCSPAPEALRELPGPLPATDTGPGGAQSPVRPGCDCEGNR    141 - 210
PAEPPAPGGTSPSSDPGIEADLRSRSSGGRGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSS    211 - 280
DGGSSSSGRSSHLTNSIEEASSPASEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWL    281 - 350
LSNLVSRMISEGSSPIRCPGQCLSPAPRPPGEPVSPAGGAAQDSQDPEAAAGPGGVELVDMETLCAPPPP    351 - 420
APAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRACSAACSEEEDEEDDEEEEDAEDSAGSPG    421 - 490
GRGTGPSAPRDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGHDSEEDSGGEASEEEAGAALLGGGQVS    491 - 560
GDTSPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLVNGEEREQTHRAVFRFIPRHPDELELDVDDP    561 - 630
VLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNG    631 - 700
ILCAAMQKIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYF    701 - 770
GFITKHPLLSRFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE                    771 - 824
//

Text Mined References (25)

PMID Year Title