Property Summary

NCBI Gene PubMed Count 24
PubMed Score 506.21
PubTator Score 413.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.03153527365957E-12
ependymoma 2514 6.46969281209213E-12
atypical teratoid / rhabdoid tumor 4369 1.46672558258842E-9
pilocytic astrocytoma 3086 2.45085210929404E-9
juvenile dermatomyositis 1189 6.15034260062226E-8
pediatric high grade glioma 2712 3.54773968974727E-7
medulloblastoma 1524 3.58731138512924E-7
ovarian cancer 8492 6.68134022656254E-6
glioblastoma 5572 2.50919326561832E-5
medulloblastoma, large-cell 6234 1.20128720949758E-4
primitive neuroectodermal tumor 3031 0.00519300128270609
subependymal giant cell astrocytoma 2287 0.0117913930926118

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma -2.300 0.000
osteosarcoma 3.329 0.000
ependymoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.100 0.005
juvenile dermatomyositis -1.164 0.000
pediatric high grade glioma -2.100 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -1.463 0.012
ovarian cancer -1.100 0.000

Synonym

Accession Q13387 Q96G62 Q99771 Q9NZ59 Q9UKQ4 JIP-2
Symbols IB2
IB-2
JIP2
PRKM8IPL

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
21048139 Human IB2 mutation has a role as a contributing genetic factor in chromosome 22-associated cognitive disorders.
12244047 there is a signaling module in which IB2 scaffolds a MLK3/MKK/p38delta kinase cascade.

AA Sequence

MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHP      1 - 70
ICSFQDDFQEFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPAPGPLIPSPSVEEPHKHRPTT     71 - 140
LRLTTLGAQDSLNNNGGFDLVRPASWQETALCSPAPEALRELPGPLPATDTGPGGAQSPVRPGCDCEGNR    141 - 210
PAEPPAPGGTSPSSDPGIEADLRSRSSGGRGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSS    211 - 280
DGGSSSSGRSSHLTNSIEEASSPASEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWL    281 - 350
LSNLVSRMISEGSSPIRCPGQCLSPAPRPPGEPVSPAGGAAQDSQDPEAAAGPGGVELVDMETLCAPPPP    351 - 420
APAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRACSAACSEEEDEEDDEEEEDAEDSAGSPG    421 - 490
GRGTGPSAPRDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGHDSEEDSGGEASEEEAGAALLGGGQVS    491 - 560
GDTSPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLVNGEEREQTHRAVFRFIPRHPDELELDVDDP    561 - 630
VLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNG    631 - 700
ILCAAMQKIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYF    701 - 770
GFITKHPLLSRFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE                    771 - 824
//

Text Mined References (24)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24551779 2012 Evaluation of PKM2 and MAPK8IP2 Polymorphism in Ameloblastic Carcinoma: A Retrospective Quantitative Study.
23225497 2013 Cerebellar and posterior fossa malformations in patients with autism-associated chromosome 22q13 terminal deletion.
21048139 2010 Behavioral and cerebellar transmission deficits in mice lacking the autism-linked gene islet brain-2.
20173330 2010 LRRK2 and the stress response: interaction with MKKs and JNK-interacting proteins.
16456539 2006 A unique set of SH3-SH3 interactions controls IB1 homodimerization.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
More...