Property Summary

NCBI Gene PubMed Count 25
PubMed Score 808.67
PubTator Score 17.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 8.4e-07
glioblastoma 1.200 7.5e-05
group 3 medulloblastoma 1.100 1.8e-02
medulloblastoma, large-cell 1.100 8.1e-04
osteosarcoma 1.205 4.1e-05

Gene RIF (7)

AA Sequence

MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFK      1 - 70
QLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQY     71 - 140
RKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYP    141 - 210
AVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVL    211 - 280
VLTSVRNSATCHSEDSDLEID                                                     281 - 301
//

Text Mined References (30)

PMID Year Title