Property Summary

NCBI Gene PubMed Count 25
PubMed Score 717.41
PubTator Score 17.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 8.39036282260589E-7
medulloblastoma 1524 8.90860770421655E-6
osteosarcoma 7933 4.07941012945703E-5
glioblastoma 5572 7.49132209099327E-5
medulloblastoma, large-cell 6234 8.11804128366697E-4

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.205 0.000
medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.100 0.001

Synonym

Accession Q13371 Q4VXB6 Q96AF1 Q9UEW7 Q9UFL0 Q9UNX1 Q9UNX2 PHLP
Symbols PhLP

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA Inparanoid

Gene RIF (7)

PMID Text
25675501 PhLP1 binding stabilizes the Gbeta fold, disrupting interactions with CCT and releasing a PhLP1-Gbeta dimer for assembly with Ggamma.
23888055 evidence of a generic mechanism, whereby the splicing of the PhLP gene could potentially and efficiently regulate the cellular levels of heterotrimeric G proteins.
19403526 PhLP-M1-G149, a Gbetagamma-interacting construct derived from phosducin-like protein 1 (PhLP) is a differential inhibitor of Gbetagamma
19376773 cytosolic chaperonin complex-dependent mechanism exists for Gbeta5-RGS7 assembly that utilizes the co-chaperone activity of PhLP1 in a unique way
16717095 PhLP phosphorylation permits the release of a PhLP x Gbeta intermediate from cytosolic chaperonin complex, allowing Ggamma to associate with Gbeta in this intermediate complex.
15745879 the strong inhibitory action of PhLP(S) on Gbetagamma signaling is the result of a previously unrecognized mechanism of Gbetagamma-regulation, inhibition of Gbetagamma-folding by interference with TCP-1alpha
12466282 physiological control of G-protein regulation by PhLP seems to involve phosphorylation by CK2 and alternative splicing of the regulator

AA Sequence

MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFK      1 - 70
QLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQY     71 - 140
RKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYP    141 - 210
AVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVL    211 - 280
VLTSVRNSATCHSEDSDLEID                                                     281 - 301
//

Text Mined References (30)

PMID Year Title
25675501 2015 Structures of the G?-CCT and PhLP1-G?-CCT complexes reveal a mechanism for G-protein ?-subunit folding and G?? dimer assembly.
25416956 2014 A proteome-scale map of the human interactome network.
24375412 2014 Programmed cell death protein 5 interacts with the cytosolic chaperonin containing tailless complex polypeptide 1 (CCT) to regulate ?-tubulin folding.
23888055 2013 Splice isoforms of phosducin-like protein control the expression of heterotrimeric G proteins.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19403526 2009 Differential inhibitor of Gbetagamma signaling to AKT and ERK derived from phosducin-like protein: effect on sphingosine 1-phosphate-induced endothelial cell migration and in vitro angiogenesis.
19376773 2009 Role of molecular chaperones in G protein beta5/regulator of G protein signaling dimer assembly and G protein betagamma dimer specificity.
More...