Property Summary

NCBI Gene PubMed Count 36
Grant Count 30
R01 Count 15
Funding $1,970,816.74
PubMed Score 75.55
PubTator Score 242.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26283042 Our results shed more light on phosphodiesterase 3A activation and could be relevant to the treatment of severe hypertension in the general population.
25208829 Data indicate that genome-wide significant associations were found both at age 6 and 14 with single nucleotide polymorphisms (SNPs) on chromosome 11p15 in phosphodiesterase 3B, cGMP-inhibited protein PDE3B/cytochrome P-450 CYP2R1 genes.
22001403 PDE3B appears to be an important actor in regulation of energy metabolism and energy intake. Is inhibition of PDE3B a possible target for treatment of obesity or type 2 diabetes mellitus? [REVIEW]
21963837 Rescue of low O(2)-induced ATP release from erythrocytes of type 2 diabetics by cilostazol restored the ability of erythrocytes to participate in the regulation of perfusion distribution in skeletal muscle.
21724851 PDE3B and the anti-lipolytic action of insulin may have a role in increased S-nitrosylation of adipose tissue in obesity
21393242 PDE3B and EPAC1 bind directly through protein-protein interactions
21152070 PDE3B is activated in response to agents relevant for beta-cell function and activation is linked to increased as well as decreased phosphorylation of the enzyme
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19569180 Data suggest that five novel genes, LUM, PDE3B, PDGF-C, NRG1 and PKD2, have great potential for predicting the efficacy of cisplatin-based chemotherapy against OSCC.
More...

AA Sequence

MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELRPPPASPQQPR      1 - 70
RCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLSPLFSIACAFFFLTCFLTRTK     71 - 140
RGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGDAGSAAPHTPPEAAAGRLLLVLSCVGLLLTL    141 - 210
AHPLRLRHCVLVLLLASFVWWVSFTSLGSLPSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSS    211 - 280
AAEEKVPVIRPRRRSSCVSLGETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNG    281 - 350
VDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG    351 - 420
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPK    421 - 490
QRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPN    491 - 560
TPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDS    561 - 630
RKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVM    631 - 700
YTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTG    701 - 770
NETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ    771 - 840
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKAN    841 - 910
DVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRS    911 - 980
SPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPR    981 - 1050
RKSRRRIFCQLMHHLTENHKIWKEIVEEEEKCKADGNKLQVENSSLPQADEIQVIEEADEEE           1051 - 1112
//

Text Mined References (42)

PMID Year Title
26283042 2015 Clinical effects of phosphodiesterase 3A mutations in inherited hypertension with brachydactyly.
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
22001403 2011 From PDE3B to the regulation of energy homeostasis.
21963837 2011 A selective phosphodiesterase 3 inhibitor rescues low PO2-induced ATP release from erythrocytes of humans with type 2 diabetes: implication for vascular control.
21724851 2011 Increased adipocyte S-nitrosylation targets anti-lipolytic action of insulin: relevance to adipose tissue dysfunction in obesity.
21393242 2011 A phosphodiesterase 3B-based signaling complex integrates exchange protein activated by cAMP 1 and phosphatidylinositol 3-kinase signals in human arterial endothelial cells.
21152070 2010 Expression and regulation of cyclic nucleotide phosphodiesterases in human and rat pancreatic islets.
More...