Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.60
PubTator Score 10.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
group 4 medulloblastoma 2.600 0.000
subependymal giant cell astrocytoma -1.967 0.005

Gene RIF (7)

PMID Text
25780926 a central role of CADM1 in stabilizing the complex with 4.1B and MPP3
24513266 MPP3 plays an important role in hepatocellular carcinoma metastasis by promoting cell migration and invasion via up-regulating MMP1
24503895 MPP3 and Dlg, membrane-associated guanylate kinase homologs (MAGuK) proteins, connect CADM1 with p85 of PI3K by forming a multi-protein complex at the periphery of cells.
23011156 Data suggested that epigenetic inactivation of MPP3 frequently occurred during the development of colorectal cancer and might also be a potential biomarker for molecular classification of colorectal cancer patients.
17669239 TSLC1 strongly inhibits the growth of HepG2 cells in vitro and induces apoptosis.
16519681 These data implicate a role for MPP3 in photoreceptor polarity and, by association with MPP5, pinpoint MPP3 as a functional candidate gene for inherited retinopathies.
13679854 MPP3, a human homologue of a Drosophila tumor suppressor gene (Discs large), associates with TSCL1, a tumor suppressor gene.

AA Sequence

MPVLSEDSGLHETLALLTSQLRPDSNHKEEMGFLRDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVA      1 - 70
LAEDVMEELQAASVHSDERELLQLLSTPHLRAVLMVHDTVAQKNFDPVLPPLPDNIDEDFDEESVKIVRL     71 - 140
VKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSI    141 - 210
TLKIIPATQEEDRLKESKVFMRALFHYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTN    211 - 280
LRAGLIPSKGFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGLRRSFRLGCRER    281 - 350
LGGSQEGKMSSGAESPELLTYEEVARYQHQPGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVPHT    351 - 420
TRPRKSHEKEGVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALKQ    421 - 490
LRTSEFKPYIIFVKPAIQEKRKTPPMSPACEDTAAPFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQG    491 - 560
AYSQLKVVLEKLSKDTHWVPVSWVR                                                 561 - 585
//

Text Mined References (15)

PMID Year Title
25780926 2015 Dynamic regulation of a cell adhesion protein complex including CADM1 by combinatorial analysis of FRAP with exponential curve-fitting.
24513266 2014 Membrane palmitoylated protein 3 promotes hepatocellular carcinoma cell migration and invasion via up-regulating matrix metalloproteinase 1.
24503895 2014 Trans-homophilic interaction of CADM1 activates PI3K by forming a complex with MAGuK-family proteins MPP3 and Dlg.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23011156 2012 MPP3 inactivation by promoter CpG islands hypermethylation in colorectal carcinogenesis.
17669239 2007 [The growth inhibition effects of TSLC1 gene on human hepatocyte carcinoma cell line HepG2].
16519681 2006 MPP3 is recruited to the MPP5 protein scaffold at the retinal outer limiting membrane.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...