Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.95
PubTator Score 6.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.100 2.2e-03
astrocytoma -1.500 2.4e-18
Astrocytoma, Pilocytic -1.500 2.7e-06
atypical teratoid / rhabdoid tumor -3.000 2.8e-11
ependymoma -1.600 4.3e-02
glioblastoma -1.900 3.1e-07
lung carcinoma 2.300 1.0e-47
medulloblastoma, large-cell 1.500 1.0e-04
oligodendroglioma -1.200 4.8e-10
Pick disease -1.800 1.6e-03
pituitary cancer -1.200 5.7e-05
subependymal giant cell astrocytoma -2.450 2.9e-02

 GO Function (1)

Gene RIF (6)

AA Sequence

MSAAPAYSEDKGGSAGPGEPEYGHDPASGGIFSSDYKRHDDLKEMLDTNKDSLKLEAMKRIVAMIARGKN      1 - 70
ASDLFPAVVKNVACKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRGLKDPNQLIRASALRVLSSIRVP     71 - 140
IIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLYSLDSDQKDQLIEVIEKLLADKTTLVAGSVVMAFEEVC    141 - 210
PERIDLIHKNYRKLCNLLIDVEEWGQVVIISMLTRYARTQFLSPTQNESLLEENAEKAFYGSEEDEAKGA    211 - 280
GSEETAAAAAPSRKPYVMDPDHRLLLRNTKPLLQSRSAAVVMAVAQLYFHLAPKAEVGVIAKALVRLLRS    281 - 350
HSEVQYVVLQNVATMSIKRRGMFEPYLKSFYIRSTDPTQIKILKLEVLTNLANETNIPTVLREFQTYIRS    351 - 420
MDKDFVAATIQAIGRCATNIGRVRDTCLNGLVQLLSNRDELVVAESVVVIKKLLQMQPAQHGEIIKHLAK    421 - 490
LTDNIQVPMARASILWLIGEYCEHVPRIAPDVLRKMAKSFTAEEDIVKLQVINLAAKLYLTNSKQTKLLT    491 - 560
QYVLSLAKYDQNYDIRDRARFTRQLIVPSEQGGALSRHAKKLFLAPKPAPVLESSFKDRDHFQLGSLSHL    561 - 630
LNAKATGYQELPDWPEEAPDPSVRNVEVPEWTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESE    631 - 700
SDSKSSSESGSGESSSESDNEDQDEDEEKGRGSESEQSEEDGKRKTKKKVPERKGEASSSDEGSDSSSSS    701 - 770
SESEMTSESEEEQLEPASWSRKTPPSSKSAPATKEISLLDLEDFTPPSVQPVSPPAIVSTSLAADLEGLT    771 - 840
LTDSTLVPSLLSPVSGVGRQELLHRVAGEGLAVDYTFSRQPFSGDPHMVSVHIHFSNSSDTPIKGLHVGT    841 - 910
PKLPAGISIQEFPEIESLAPGESATAVMGINFCDSTQAANFQLCTQTRQFYVSIQPPVGELMAPVFMSEN    911 - 980
EFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLD    981 - 1050
ARPAGAAQLTVNSEKMVIGTMLVKDVIQALTQ                                         1051 - 1082
//

Text Mined References (23)

PMID Year Title