Property Summary

NCBI Gene PubMed Count 129
Grant Count 237
R01 Count 157
Funding $20,756,755.15
PubMed Score 269.35
PubTator Score 87.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.443 0.016
Multiple myeloma 2.791 0.000
astrocytic glioma -1.500 0.031
psoriasis -2.600 0.000
osteosarcoma -2.675 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.013
Polycystic Ovary Syndrome -1.503 0.024
ovarian cancer 3.000 0.000

Synonym

Accession Q13363 Q4W5N3 Q7Z2Q5 CtBP1
Symbols BARS

Gene

PANTHER Protein Class (2)

PDB

1MX3   4LCE   4U6Q   4U6S  

 GWAS Trait (1)

Gene RIF (75)

PMID Text
26377223 human chorionic gonadotropin stimulated miR-212, which down-regulated OLFM1 and CTBP1 expression in fallopian and endometrial epithelial cells to favor spheroid attachment
26337822 It is a putative target gene of miR-137 in breast neoplasms.
25728771 MCRIP1, an ERK substrate, mediates ERK-induced gene silencing during epithelial-mesenchymal transition by regulating the co-repressor CtBP.
25633289 C-terminal-binding protein (CtBP) was found to have an essential role in promoting glutaminolysis by directly repressing the expression of SIRT4.
25483087 CtBP physically interacted with TCF-4, and this interaction was significantly inhibited in the presence of MTOB. The above findings point to a novel role of CtBPs in the promotion of CSC growth and self-renewal
24842953 High CtBP1 expression is associated with Prostate tumor.
24732800 Transactivation of Ctbp was dependent on the histone H3 lysine 9 (H3K9) demethylase activity of LSD1 facilitates subsequent H3K9 acetylation by the NeuroD1-associated histone acetyltransferase, P300/CBP-associated factor.
24657618 Crystal structures of human CtBP1 and CtBP2 in complex with 4-Methylthio 2-oxobutyric acid and NAD.
24280726 A transgenic model suggests transcriptional activities of CtBP1 for epithelial mesenchymal interplay and a possibility of a pathogenic role in hair follicle morphogenesis and differentiation.
23940047 dinucleotide binding permits CtBP1 to form an intranuclear homodimer through a Trp(318) switch, creating a nucleation site for multimerization through the C-terminal domain for tetramerization to form an effective repression complex
More...

AA Sequence

MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEA      1 - 70
VGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLY     71 - 140
RRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDG    141 - 210
VERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALK    211 - 280
EGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNC    281 - 350
VNKDHLTAATHWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHA    351 - 420
PSPGQTVKPEADRDHASDQL                                                      421 - 440
//

Text Mined References (133)

PMID Year Title
26377223 2015 MicroRNA-212 Regulates the Expression of Olfactomedin 1 and C-Terminal Binding Protein 1 in Human Endometrial Epithelial Cells to Enhance Spheroid Attachment In Vitro.
26337822 2016 miR-137 suppresses the invasion and procedure of EMT of human breast cancer cell line MCF-7 through targeting CtBP1.
25728771 2015 MCRIP1, an ERK substrate, mediates ERK-induced gene silencing during epithelial-mesenchymal transition by regulating the co-repressor CtBP.
25633289 2015 CtBP maintains cancer cell growth and metabolic homeostasis via regulating SIRT4.
25483087 2014 Inhibition of C-terminal binding protein attenuates transcription factor 4 signaling to selectively target colon cancer stem cells.
25416956 2014 A proteome-scale map of the human interactome network.
24842953 2014 Prostate tumor growth is impaired by CtBP1 depletion in high-fat diet-fed mice.
24732800 2014 CtBP and associated LSD1 are required for transcriptional activation by NeuroD1 in gastrointestinal endocrine cells.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24657618 2014 Crystal structures of human CtBP in complex with substrate MTOB reveal active site features useful for inhibitor design.
More...